SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006654 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006654
Domain Number 1 Region: 445-569
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-30
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 239-344
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-28
Family Cadherin 0.0005
Further Details:      
 
Domain Number 3 Region: 345-449
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 130-237
Classification Level Classification E-value
Superfamily Cadherin-like 3e-22
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 561-670
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 6 Region: 32-128
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000114
Family Cadherin 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006654   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000006805
Sequence length 992
Comment pep:known_by_projection chromosome:TETRAODON8:1:4865:129925:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000006805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHRLSRGSWVPVAGLVICLLLCACVVDLVLAQIRYSIPEELEHGAFVGNIAEDLGLDVA
KLSARRFRIVSGAKKQYLEVNLENGILFVNEKIDREELCERSPSCFLHLQVVIENPLELY
RVEVEILDVNDNSPSFPWSEFNLDITESAAPGSRFPLESAQDQDVGSNSLRSYTLSANAH
FVLNIQTRNDGSKFAELVLDTQLDREQQKKHEMVLTAFDGGSPERSGTALITVTVLDAND
NVPVFDRSVYRASLVENAPRGTLVLKLNATDLDEGSNGEVTYAFSGHAPLKVRELFNVDP
YTGEIRVKGVVDYEKASVYELFVQAKDRGPAVAVHSKVLVDILDVNDNAPEVILTSVSTP
VQEDAPPGTVIAVISVMDRDSAENGNVDCQIPSNVPFQLHSSFRNYYTLVTSEYLDREAV
SEYNITLTARDLGAPSLSTRKTILVQVSDINDNPPRFSQPSYTVYVTENNAPGASICSVS
AFDPDSNQNAYLSYSILEGQIQGMPVSTYVSINSDNGNIYALRSFDYEQLRNFQILVQAQ
DAGFPPLASNITVNVFVLDQNDNAPVIVSPLPKNGSVAAEVVPRSVDAGYLVTKITALDA
DAGQNSRLSYQVLQATDPGLFSVALYTGEIRTIRRVVEKDATRHRLVILVKDNGQPSLSA
TVSLVLTVVDSVPESLSDFGDLTLSPQPPSNLALYLIVSLSTISLIFLVAIIVLAAIKCY
KDRETVSGYNLPPFACCCCGGFQPEPPPEVFKKSNLNLQISSATKVPTNCMEVNGNSTLS
QSYCYKVCLTPESAKSDFMFLKPCSPGSTPRNNEAKSAECSWNAQSRCSSVNNGATTPNE
PKMPSADWRYSASLRAGGVMQSSVHMEESSVMQGAQGVLVQNWPTASSAADAEGGEVSPP
MGAGVDSNSWHFRYGPGGPGAPPQHLKPGEVPPEAFIIPGSPAIISIRQNQGGEDDKSDF
ITFGKKEEAKKKKKKKKEKKDKKDKGKDDGDE
Download sequence
Identical sequences H3CEI0
ENSTNIP00000006654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]