SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006675 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006675
Domain Number 1 Region: 7-175
Classification Level Classification E-value
Superfamily E set domains 5.95e-76
Family Arrestin/Vps26-like 0.000000289
Further Details:      
 
Domain Number 2 Region: 181-327
Classification Level Classification E-value
Superfamily E set domains 3.83e-29
Family Arrestin/Vps26-like 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006675   Gene: ENSTNIG00000004064   Transcript: ENSTNIT00000006826
Sequence length 331
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:25563190:25571837:1 gene:ENSTNIG00000004064 transcript:ENSTNIT00000006826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKTGTRVFKKTSPNSKLTVYLGRRDFVDHVSCVDPVDGIVLVEPEYLKDRKVFVTLNC
AFRYGQEDLDVLGLSFRKDLFAKTIEVFPPAEKDQKPANLQNRLLTKLGQNAYPFTFTIP
QNLPCSVTLQPGPQDSGKACGVDYELQAFCAKSADEKIHHRNSVHLVIRKVQFAPETPGP
QPIETHRSYLMSDRSLHLEASLDKEVTHTWVFCKLQRNKNTHNACSFLVPVRQYADICLF
SMAQYKCQVAHLEADDQISPSSTSCHIYTLTPLLRNNREKRGLALDGKLKHEDTNLASST
IIKEGASKEMMGILVSYRVKVKLVVSLGGYV
Download sequence
Identical sequences H3CEK1
ENSTNIP00000006675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]