SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006689 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006689
Domain Number 1 Region: 126-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-42
Family MAM domain 0.0009
Further Details:      
 
Domain Number 2 Region: 326-479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.02e-35
Family MAM domain 0.0013
Further Details:      
 
Domain Number 3 Region: 4-87
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000237
Family MAM domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006689   Gene: ENSTNIG00000004078   Transcript: ENSTNIT00000006840
Sequence length 517
Comment pep:novel chromosome:TETRAODON8:Un_random:21043933:21053001:1 gene:ENSTNIG00000004078 transcript:ENSTNIT00000006840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPKTEMCVRFWYWLPAGSPDSLTVYLLSNGELSEAIWQQSGVPSLSWEVAEVTVSSSAEF
RVVFRYKSGHGHKGLVAVDDISFSRECIFDPKNGNLPDTLPTSGPGSTPSGVRLQSPRLP
LSSPYCQILCSFEDGLCVWVQGAEDQLDWISGSGPTETPNTGPTVDHTTGKGKYLYIKSS
LPSVRGHMAQLKSPLLPSAGDVGHCFTFWHHMFGATVGSLRMLLQTTDPRNKVWQKSGNQ
GDEWQLVQIHVTLQSVYQVILEATVGGEAGDIAIDDLSLSYGPCTASSGDIFSHSIEEKI
WSLYASSTGAHNRYSTTIIPSPADLCDFEEGNCGWQQQTDDDFDWVRQSGPTHNPNTGPD
SDHTTNAPSGHYYYLSSSNTDRAGQTARMSSPLYPSGKNSCVQLWYHMLCLNIYQQVAGE
TPALLFSKMGDQGQLWRFAQAGLLFHDRPYRVMVEGVKAGPTQVGDMAFDDVMLTDAPCP
SPGHCDFEINMSRRSKQGKDDDEDWLRGRGNSSIQHR
Download sequence
Identical sequences H3CEL5
99883.ENSTNIP00000006689 ENSTNIP00000006689 ENSTNIP00000006689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]