SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006699 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006699
Domain Number 1 Region: 60-519
Classification Level Classification E-value
Superfamily Sema domain 2.75e-135
Family Sema domain 0.0000000111
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006699
Domain Number - Region: 523-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.0209
Family Plexin repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006699   Gene: ENSTNIG00000004086   Transcript: ENSTNIT00000006850
Sequence length 642
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:66249977:66254183:-1 gene:ENSTNIG00000004086 transcript:ENSTNIT00000006850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAGERRLPRPAPSLSPLMLFLGTPCLMGVVYPPFDSQTCLFPPLPVSFFESPLNQVSFSF
FLLADLVGPREFGGVTNFSTFLLDRSTGVLFMGARDAILAVDTNRRNQPPKKISWEVPEK
KRQSCVTKGKTEVDCKNYIRLLQFLPDGRVYVCGTYAFDPQCAFLELSTFTLEKAPDGGV
KMESGKGKCPFEPSQHYTAVMADGTLYTAATSNFLGTLFDISRATGPDQERIRTEQSINW
LNDPEFVSSAFVQQSAENNPTGEDDKIYFFFTEVAKEYDLYTKVKVPRVARVCKSDLGGL
KTLQRRWTTFLKAQLVCEDKPSGQRYNVLTDVFTVQPAPGDPSTRFYGLFTSQWEGEEVS
AVCVFSLSDINKVLNGPFKELKKSENWINADLVPTPRPGQCLNNDLKAKGIETSLKLPDK
VLTFVRDHPLMENSVSAAPLLVRKGITYTKLAVAPSGRRGALLHLGTDRGELHRVAVVDQ
NTTLLQEIPLFGSQEPVNNIVLHQGRALVGSPLSLAQVPAEGCSLFPSCEVCARARGLGC
VWSAAEEACIETTAESHILQKFSPFLKNQIPWRFPGRCSPSIREMRVSLGLRVLLPCVQL
SPRPCSWEHPPDRHTRQHHSDLKVVVSPGSLGKYVCTCQEGG
Download sequence
Identical sequences H3CEM5
ENSTNIP00000006699 ENSTNIP00000006699 99883.ENSTNIP00000006699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]