SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006702 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006702
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily PR-1-like 9.94e-36
Family PR-1-like 0.00025
Further Details:      
 
Domain Number 2 Region: 251-350
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-19
Family C-type lectin domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006702   Gene: ENSTNIG00000004089   Transcript: ENSTNIT00000006853
Sequence length 351
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:66290306:66293899:-1 gene:ENSTNIG00000004089 transcript:ENSTNIT00000006853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEYWMVAQHNRLRSRVQPMAANMQKMEWNEKLAALANCNSEPLAPNSTHSHIGWNTHISA
LGANSFSDVIEAWFKEGNDFLYPSGKCRGNATCQHYTQLVWATSSQVGCASQLCFREGEL
WEMFVCAYFPGGNWEVKGQLVAPYKAGLSCTLCTSAMSGCFRLWDHKGGLCEVPVNPCRM
SCGQHGHLNVSSCKCKCDPGFTGRLCQGVRCRVECAHGRFREEECSCICDEGYGGPACTE
RVRFPLHSCDLVIDGDCFVVSSEADTYYGARNRCQERGGNLAHILNQKVQDILAFYLGQL
GTNNELTNDGFETQNFWIGLTFKPLKDSFRWDSGEILQFSSFAFGQPDNQG
Download sequence
Identical sequences H3CEM8
99883.ENSTNIP00000006702 ENSTNIP00000006702 ENSTNIP00000006702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]