SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006740 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006740
Domain Number 1 Region: 4-180
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.85e-56
Family Glutathione peroxidase-like 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006740   Gene: ENSTNIG00000004123   Transcript: ENSTNIT00000006891
Sequence length 180
Comment pep:known_by_projection chromosome:TETRAODON8:1:12578416:12580498:1 gene:ENSTNIG00000004123 transcript:ENSTNIT00000006891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLLLGDEFPNFEANTTIGTIKFHDFLGSSWGILFSHPKDFTPVCTTELARAAKLSEEF
KKRDVKMIALSIDSVEDHCSWSKDVMALNAEPKRPLPYPIIADDKRQLSVQLGMLDPDEL
DKDGIPLTARCVFVIGPDKKLKLSILYPATTGRNFDELLRVIDSLQLTAQKKVATPVDWK
Download sequence
Identical sequences H3CER6
99883.ENSTNIP00000006740 ENSTNIP00000006740 ENSTNIP00000006740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]