SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006766 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006766
Domain Number 1 Region: 25-502
Classification Level Classification E-value
Superfamily Sema domain 2.35e-117
Family Sema domain 0.0000286
Further Details:      
 
Domain Number 2 Region: 1343-1473,1668-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-51
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 851-949
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000022
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 1035-1139
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000168
Family E-set domains of sugar-utilizing enzymes 0.076
Further Details:      
 
Domain Number 5 Region: 947-1036
Classification Level Classification E-value
Superfamily E set domains 0.000000000000153
Family Other IPT/TIG domains 0.075
Further Details:      
 
Domain Number 6 Region: 505-554
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000131
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 803-839
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000628
Family Plexin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006766
Domain Number - Region: 1150-1227
Classification Level Classification E-value
Superfamily E set domains 0.000192
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006766   Gene: ENSTNIG00000004146   Transcript: ENSTNIT00000006917
Sequence length 1887
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:66905307:66936962:1 gene:ENSTNIG00000004146 transcript:ENSTNIT00000006917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSIICFAVRLYLLNKVRSGRAVYRPFDTSLTHLTVHRRSGEVFVGAVNRVLKLSANLTEL
RSHMTGPVEDNAKCYPPPSVRACAHRLEWSDNVNKLLLVDYAGNRLVACGSIWQGVCQFL
RLEDLFKLGEPHHRKEHYLSGAREADGMAGVVVGEDDWTTDPKSKKAERSGSRLFIGAAI
DGKSEYFPTLSSRKLVADEESVNMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYVYGFS
SRTYVYFLTLQLDTQLTQMDAGGEKFFTSKIVRMCSNDTDFYSYVEFPLGCTKDGVEYRL
VQAAYKQKPGRRLAQALGLSQEDDVLFVIFSQGQKNRSNPPRETVLCLFTLHDINLAMRE
RIRSCYRGEGRLSLPWLLNKELPCIHTPQKIGDDFCGLVLNQPLGGLRVIEGSPLYEDRT
EGMGAVAAYTYGEHTVVFVGTRSGQLKKIRVDGVPTASQNALLYETVTVVEGKPILRDMV
FSPDHQFIYLLSDRQQVSRLPVESCEQYSSCSSCLGSGDPHCGWCVLFNMCSRQEACHKW
EEPQHFNTRLDQCVDISVTPSNLSVTSPSTQLTIRVENVPALSGGVSCVFEDLSETPGEV
RPKGQVVCMSPSLRELPVQMQSPGETRARELSLRSTETGHQFISTSFVYYNCSVLNSCTS
CVSSVFPCHWCKYRHICTNNLQDCSFQEGRVSGMEGCPQIVPTSDILVPAEWVRPITLRA
RNLPQPQSGQKNYECVFNIQGKVQRIPAVRFNSSCIQCQNTSYWYEGDEAGDLPVDFSIV
WDGDFFIDKPTSMKALLYKCEAQRSSCGQCLKAPPAFECGWCVETRKCLLRQHCPTPEQN
WMHHGRHNLRCSHPRITKISPLTGPREGGTRVTIEGENLGLQVKEIAYVQVAGVRCSSVP
SQYVSAERVVCDMAEALLPHSPGGPVELCIGVCSAEFRTLSSQTYSFVSPSFSRVHPEKG
PVSGGTRLTVTGRHLDAGSSVSCIINKEECLFVKRTNREIICITPASLSGSGPASIRLMI
DKAEVTSSETKYVYTEDPTITSIEPNWTILNGSTMITVTGTNLLTIQEPKVRAKYGGVET
SNFCTLVNDSTMTCLAPGLVYNKLAPPEGALHPEEFGFIFDQVSSLLVLNSTPFTHYPNP
IFDPLGSSGILEVKPGSPIILKGKNLIPPAPGNGRLNYTVLIGESPCLLTVSENQLLCDS
PDLTGEQRVLILVGGLEYSPGMLHIYSDSALTLPAIIGIGAGGGVLLIAIIAVLIAYKRK
TRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIQELTNDMDGVKIPFLEYRTYTMR
VMFPGIEEHPVLKELDSPANVEKALRLFSQLLNNKIFLLTFIHTLEAQRSFSMRDRGNVA
SLLMAALQGRMEYATVVLKQLLADLIEKNLENRNHPKLLLRSRTESVAEKMLTNWFTFLL
HRFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKQLTLMCIP
PEGEAGTEVPVKVLNCDTVTQVKDKLLDAVYKGIPFSQRPQADDMDLEWRQGRMTRIILQ
DEDVTTKIESDWKRLNTLAHYQVTDGSLVALVQKQVSAYNIANSFTFTRSLSKYESLLRT
SSSPDSLRSRAPMITPDQETGTKLWHLVKNHEHSDQREGDRGSKMVSEIYLTRLLATKGT
LQKFVDDLFETVFSTAHRGSALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRF
WVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNY
KSWVERYYRDITKMPSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKYKEEILTA
LDRDGYCRKHKLRHKLEQAINLMSGSS
Download sequence
Identical sequences H3CEU2
ENSTNIP00000006767 99883.ENSTNIP00000006766 ENSTNIP00000006766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]