SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006807 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006807
Domain Number 1 Region: 545-757
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-51
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 235-378
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-43
Family Third domain of FERM 0.00056
Further Details:      
 
Domain Number 3 Region: 893-1035
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-33
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 4 Region: 742-865
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-31
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 5 Region: 137-237
Classification Level Classification E-value
Superfamily Second domain of FERM 5.23e-25
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 6 Region: 51-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000157
Family First domain of FERM 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006807   Gene: ENSTNIG00000003257   Transcript: ENSTNIT00000006958
Sequence length 1035
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:57858864:57877864:1 gene:ENSTNIG00000003257 transcript:ENSTNIT00000006958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDIEGSYRVLQTPGTRLGAQFNAGISTLEPGQSLAGNMISSHRNFGRTLQIRVHGLDDS
QEFFDMDPKALGQSLLSEVFFRGNLIESDYFGLEFQNILMNWVSTKRNPNWNSEMSEKKK
LNPTLTSPLKCWHVNRTYLTETNKRYLFSLQMKRDLMEGRLICTENTGALLVSHLVQAEM
GDYDDVADRDFLRMHKFLPYQEKVQERIMELHCRHQGQTPAESDFQILEIARKLEMYGVR
FHPAADREGTKINLSVSHMGLQVFQGHTKINTFNWSKIRKLSFKRKWFLIKLHPEVHGPH
QDTLEFLMASRDQCKIFWKICVEYHSFFRLFDQPQPKTKAIFTRGSSFRYSGRTQKQLVE
FIRENGSKRTAYQRRNSKIRMSARSVATEVPTQNLSFSDSVRASGAPPSAVVSFYPTHNP
SIVPRIPMFACLESSSSLSQPSKNGNEDTLNQRRGAEAVVGGSGLKRKGPFTPEAFQPFP
SFKTRIPQLLPFSAQGPLSPSLQMSNLSLSGQAPSPLQSPILSEVGNNVRLEEEEEGRRK
RYPTDKAYFIAKEILTTERTYLKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPIYEF
HRDFFKELDQRLALWEGRSNAHVKGDCQRIGDVMLRNMCALKEFTSYLQKHDEVLTELEK
ATKRMKKLETVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPTHRDHDDC
KEALKEVADIAAQLQSSLIRLENFQKLTELQRDLIGIENLTAPGRKFIREGCLYKLTKKG
LQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLHGMIVEESENEWSVPHCFTIYSAQRT
VVVAASSKVEMGKWIEDLNMAIDMARTSQEKSSVFLDGGLGDHSNRSSDEVSVEQESEED
INSSRTSLDKQAHHRANTTIHVCWHRNTSVSMSDHSLAVENQLSGYLLRKFKNSNGWQKL
WVVFTNFCLFFYKTHQDDFPLASLPLLGYTVGTPEESDSIHKEYVFKLQFKSHVYFFRAE
SEYTFERWMEVIKSA
Download sequence
Identical sequences H3CEY3
ENSTNIP00000006807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]