SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006834 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006834
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.41e-19
Family PB1 domain 0.00012
Further Details:      
 
Domain Number 2 Region: 208-258
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000989
Family ZZ domain 0.02
Further Details:      
 
Domain Number 3 Region: 891-928
Classification Level Classification E-value
Superfamily UBA-like 0.000000312
Family UBA domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006834   Gene: ENSTNIG00000004210   Transcript: ENSTNIT00000006985
Sequence length 939
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:6068214:6077820:1 gene:ENSTNIG00000004210 transcript:ENSTNIT00000006985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFYINLRVNFRGNSKNFLLSGSETKSWESMEAMVKRSFGLCSLQLTYFDEENEEVSINS
QVEYEEALRSAARQGNRLHMNVYETRGQPARVPTNKTSATEPKRGFRPPQHCPTLAQVVS
RKVQAAVPEQGMVIMKEMKGGKDEDKTPPAWFTSYMEKFKDQVVREAVEKICREFSGQCC
IHKPAEAQQVPEVSSSTLPGAPSSSTPPCSSCRGQTTGGGYQCSVCTSCTLCEPCSFSHD
PSHNLVRARTPLSIPEHGSPAPDHSRFIFRSVFSAASFRFYRRGDRSFRKAEKQRLKAEK
RLLKAEVKEIRKQLRMERRGIQWSSSHREGSSSPVLLQPRATQHNSPERPKRPCPLVVPA
MMAAFLDENLPDGTRLRPGTKFIKYWKMRNTGTVSWNADTKLKFMWGNLAVGSGDRWREV
SVPFLQPGQVGIVNVALVAPSVEGSYTSHWRLAHAGEQFGPRVWCSIVVDPLAPAPVMAD
GILVSPCVTPQVGGVTVMKDGKACTASREPPLLSVDQEEYYIPSVDLLTAQDLLSFELLD
INIVQELENVPNNTPADRTPCISPLPQDGHLQDKGSPSLGLIQEESESGDVKHQCDALVE
LAKNGGGVPAQEEGEDDISGTQFVCETVIRSMTLEEAPDHTPPRGPPPGTAPLSVALTLG
PGPSSAPVPLHVAPGAATLQYEETLSDRKGKFEISGPRSRSSSTSSEDYIIILPDCFDTS
RPLGESMYSSALSQPGDVPAKTSADAETPSPDQSAATGEEVGGAGVLPRTGVSGSSSAND
MLCTSQTLDDEPLTPEVVAPPTAVVTPRSVGPKRCFSTPPVASIPWPLRALPSGKAARQN
GCLGSCDSRNGHPGITRGLMKGALSVAASAYKALFTGQGPTQPPVDASTQDTMMAVLVEM
GFGDRPLNQRLLNKYNYNLLDVVNELVQMSDNDWFSTRY
Download sequence
Identical sequences H3CF10
ENSTNIP00000006834 99883.ENSTNIP00000006834 ENSTNIP00000006834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]