SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006847 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006847
Domain Number 1 Region: 340-557
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.42e-75
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000000796
Further Details:      
 
Domain Number 2 Region: 207-338
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 6.02e-44
Family Domain of poly(ADP-ribose) polymerase 0.00000391
Further Details:      
 
Domain Number 3 Region: 58-184
Classification Level Classification E-value
Superfamily WGR domain-like 5.36e-38
Family WGR domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006847   Gene: ENSTNIG00000004223   Transcript: ENSTNIT00000006998
Sequence length 561
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:33831871:33838453:-1 gene:ENSTNIG00000004223 transcript:ENSTNIT00000006998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQINPVTKYKRKIRSQIKEEEEEEDTNKQPAAKRRRGQSKSQTKCEEMPKEEIKSKEVV
KTLVLKGKAPVDSECKAKLGKAHVYSEGNDVYDVMLNQTNLQFNNNKYYLMQLLEDDGSK
LYSVWFRWGRGHLVGKVGQNSLTECTTDLNKAKDIFKKKFFDKTKNEWERKDQFEKVAGK
YDMVFMDYSTEEKEKKHSVVETKKQASKLDVKIQSLLELICDLKAMEECVLEMKFDTRKA
PLGKLTPEQIRAGYVALRKIEDCLKKKASHRQLLEACNQFYTRIPHDFGLKTPPIIQTEQ
ELKDKIALLEALSDIQIAVKMVKANEDSDENPLDRQYRALQCRLQPLDAGCHEYEVIEKY
LQSTHAPTHSDYTMSVLDIFGVDREGESDSFLSDLPNSLPRTLLWHGSRLSNWVGILSQG
LRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFANQSNHVGLLLLCEVALGDSNELLDAD
YEANNLPNGKHSTKGLGRTGPDPKNALTLEGVTVPMGPGVNTGVGKHKSYTLLYNEFVIY
NPAQIRMRYLLRIKFNYSSLW
Download sequence
Identical sequences H3CF23
ENSTNIP00000006847 ENSTNIP00000006847 99883.ENSTNIP00000006847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]