SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006857 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006857
Domain Number 1 Region: 51-135
Classification Level Classification E-value
Superfamily E set domains 0.000000035
Family E-set domains of sugar-utilizing enzymes 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006857   Gene: ENSTNIG00000004232   Transcript: ENSTNIT00000007008
Sequence length 234
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:67664821:67667801:1 gene:ENSTNIG00000004232 transcript:ENSTNIT00000007008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCLAPSVAGSDKSFSEAGNSPDEIGFIMDDVPSVLVVNETFSYHPDPVFEPLSSTGLLE
LKPGSPLILKGRNLIPSAPGNTKLNYTVLIGETPCVLTLSETQLVCEWPNLTGEHKVTVR
VGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIIVLIAYKRKSRDADRTLKRLQ
LQMDNLESRVALECKEGESGGDGRSLALTQFVFISFLPLFHIPQITSSDFSHCS
Download sequence
Identical sequences H3CF33
ENSTNIP00000006857 ENSTNIP00000006857 99883.ENSTNIP00000006857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]