SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006882 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006882
Domain Number 1 Region: 3-86,130-255,287-401,500-562
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.92e-36
Family LacY-like proton/sugar symporter 0.049
Further Details:      
 
Domain Number 2 Region: 419-457
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000108
Family Ovomucoid domain III-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006882   Gene: ENSTNIG00000007996   Transcript: ENSTNIT00000007034
Sequence length 591
Comment pep:known_by_projection chromosome:TETRAODON8:15:687630:691983:1 gene:ENSTNIG00000007996 transcript:ENSTNIT00000007034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFCMCYLTFIQSLMVSGYLSSVITTIEKRYSLRSSESGLLVSCFDIGSLLVVVFISYFGG
RGQRPRWLAVGGVFIAVGAALFSLPHFISPPYQIQEVNSSSANEGLCSSSNASKDQVDVA
SCPRDQEGNEHHLYVALFIVAQILVGMGSTPIYTLGPTYLDDNVKKENASLYLAIMYVMG
ALGPAAGYLLGGVLIGFYVHPKTVVGIDQSDPRFIGNWWSGFLLCSLAMLLVIFPMFAFP
KKLPPRHKKKKRRKKLSLDDMSSEDDVLKEKSSNKSQPVSSSMGFGKDMRDLPRAAVRIL
SNVTFLFVSLSYTAESAIVTAFITFIPKFIESQFGIPASSASIYTGLIIVPSAGVGIVLG
GYIIKKLKLGARESAKLAMICSGVSLLCFSTLFIVGCESINLGGINIPYTTGPTLTMTQR
NLTGGCNVNCGCRIHEYAPVCGSDGITYFNPCLAGCRGVANDSSGGGNQLQLVIVKTYLN
ENGYAPWRWKCDRTCSTLIPFLIFLFIVTLITACAQPSAIIVTLRSVAEQERPFALGMQF
VLLRTLAYIPTPIYFGAVIDTTCMLWQQDCGVHGSCWEYDVTSLRFVYFGL
Download sequence
Identical sequences H3CF58
ENSTNIP00000006882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]