SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006897 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006897
Domain Number 1 Region: 28-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.87e-47
Family Ankyrin repeat 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006897   Gene: ENSTNIG00000004268   Transcript: ENSTNIT00000007049
Sequence length 377
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:67978844:67980444:1 gene:ENSTNIG00000004268 transcript:ENSTNIT00000007049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRQQPLQEVRAPPPQLRCRDAAVHNTFMYGDMKGVYTVLKDPGMVNALLETVKEEMVWTQ
RWPGRWTLSSRVKQTSPLRLAASRGHSGCVEELLFRGAEVNDDPGNTALHDACIGAHAAC
VQLLLAHGADCILLAADGSAPLHLCTSVQSLHCAELLLQGGAEVNVRMQESRLTPLHIAG
RRGLEEHVELFLKHGADVRATSREGETPLNAACAGAERPAEAGRYLRVIQQLLDAGADPR
TAGRKQHTPLHNACSNCSPRIVDVLLQHGARAGATNCLGYTPMDCLLQVVDDFQDQQLGA
VARSLLNHGAKPVPPKVLQRCLPSVSTLEVMLNSYVSLPPCEWVSCLPAHVYQEHQPFLQ
LLSQRGSQPRSLQHLLR
Download sequence
Identical sequences H3CF73
ENSTNIP00000006897 99883.ENSTNIP00000006897 ENSTNIP00000006897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]