SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006905 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006905
Domain Number 1 Region: 20-487
Classification Level Classification E-value
Superfamily Sema domain 5.62e-165
Family Sema domain 0.00000000013
Further Details:      
 
Domain Number 2 Region: 546-635
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000602
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 3 Region: 483-523
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000174
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006905   Gene: ENSTNIG00000004276   Transcript: ENSTNIT00000007057
Sequence length 681
Comment pep:known_by_projection chromosome:TETRAODON8:9:563541:580072:1 gene:ENSTNIG00000004276 transcript:ENSTNIT00000007057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HVQHTELIQNGRLLTLPLAAGDLHSLLPDEDGRHLYVAMKDNLLSTSLDDITQNPRKLYW
PASPDRVQECLMAGKDPELECANFLRVLQHFNQTHLYVCGTGAFNPRCAFVPTSVFRKSE
HQMLSYSQTECGKGKCPYDPFQKTASTVVDGELYAGITSDFMSRDSSFFRSLGSRRVIRT
EQYDSTWLLDAQFVRVAPLSETDNPEDDKVYMFFTERAQEAEGAAGKILYSRVARVCKND
IGGQRSLVNKWSTFQKARLVCSVPGPDGLHTHFDQLQDIFILHGKDKKNPLIYGLFTTSS
DILNGSAVCVYRMEDVVRAFKGNFLHKEGPQYKWAEFTGKVPYPRPGTCPSSTYGSYSST
REYPDDVIFFSRTHPLLQESVLPLGERPLLVRVGVHYKFSKLVVDRVEAVDSTYDVLFIG
TDSGLVLKAIHLPKDHGQSQEITLEQMQVFQHKSPVTAMTLSKKKQWLFVGSREGVSQLS
LYQCELYGQACAECCLARDPYCTWDGHACSPYMPTVRRRNARHLGEDEDPLTQCVRQGAG
LQVEAEQRVMMVAEGNSTYLECLPRSRHAAVTWYKQAGENSPELNQVVTGDQLVVIERGI
LIRQAELSHGGVYHCQVEEHGYHWTAVTVRLTVWSPFADRLLSPWSGSLYHSTGTQRWYE
DVMALIHPGNIGQHCQALGYR
Download sequence
Identical sequences H3CF81
ENSTNIP00000006905 99883.ENSTNIP00000006905 ENSTNIP00000006905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]