SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006966 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006966
Domain Number 1 Region: 108-232
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-33
Family Cadherin 0.00087
Further Details:      
 
Domain Number 2 Region: 322-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-30
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 221-327
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 5-112
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-19
Family Cadherin 0.0092
Further Details:      
 
Domain Number 5 Region: 438-546
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-17
Family Cadherin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006966   Gene: ENSTNIG00000004336   Transcript: ENSTNIT00000007120
Sequence length 595
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:68360993:68370014:-1 gene:ENSTNIG00000004336 transcript:ENSTNIT00000007120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVDVNDNSPSFPEKEKRLEISESVLPGARFQLKPSHDRDSGHFSVQQYKLSQNDHFRLEV
RDKGEDGKIPILVLHKSLDRETAGSHSLVLTALDGGKPPKSGEMTILVKVLDVNDNTPVF
SKDAYSVMLPENAPLGSAVVQVNATDLDEGQNGEVYYSFGNSVSNNLLHLFDINSLTGEI
TVRGPIDYEQKDKYEIEIEASDKGSVPLKTEKSVIVDITDVNDNAPEIEITSFSSFVMED
SRPGTTVALISVNDLDSGLNGKVICTINDNSPFALSPSLKDKMYSIVTKSPLDREQTVKY
DLTITAKDAGQPSLSSERTITVVVSDVNDNSPEFSLSPYTFYISEANQPGTSVFAVKAFD
RDENDNARVSYHILRDGSPENKLTSFLNINSETGDILALKSFDFETVKTFQFQVVASDSG
SPSLSSNVTVKVFILDQNDNAPVILYPVSSNGSAEGLEEIPRNVNAGHLVTKVRAYDADI
GYNGWLLFALQEVSDHSLFGLDRYTGQIRTLRSFTETDEAEHKLVILVKDNGNVSLSATA
TVLVKLVEPKEAFAASDVQSSAQDDEDSHVTFYLMITLGSVSVLFILLINMLSVM
Download sequence
Identical sequences H3CFE2
ENSTNIP00000006966 99883.ENSTNIP00000006966 ENSTNIP00000006966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]