SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006996 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006996
Domain Number 1 Region: 230-351
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-30
Family Cadherin 0.00074
Further Details:      
 
Domain Number 2 Region: 446-570
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-22
Family Cadherin 0.0061
Further Details:      
 
Domain Number 4 Region: 343-449
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-21
Family Cadherin 0.0041
Further Details:      
 
Domain Number 5 Region: 561-666
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-17
Family Cadherin 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006996
Domain Number - Region: 29-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.000228
Family Cadherin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006996   Gene: ENSTNIG00000004362   Transcript: ENSTNIT00000007151
Sequence length 725
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:68686380:68688735:-1 gene:ENSTNIG00000004362 transcript:ENSTNIT00000007151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHGVAVCHRRNIIRSSLMAHLMTSSAARPVTRYSIAEEMERGSVVANLAADLGLELGGLA
QREVKLDIFHNKKYLDVNKKTGELFIVEKIDREFLCPKLTSCFLKLDVIIESPLRIFNIE
LGITDINDNAPHFRRERVELDVSESASPGERFSLPNAVDPDVGINTIKTYSLSRSEHFAI
EIQTGSDGTQYVDLVLTRSLDREQTAVHHLIVTAVDGGVPARSGAADIIVKVQDTNDNPP
RFEKSVYTVNMTENTAVGTLVTKLNATDLDEGLNSEIVYSFTLYTSEKTQNVFAVSPETG
EISVKGTIDYEDMKFFELHIEARDKGAVPLLGQCKVVIVVKDVNDNYPEITIESVKNTVE
ENIPVGTVIALVAISDRDTGENGKATLSLSQSLPFTLNQSEDRPKHYSLVVSEPLDREAV
SDYDITLVVTDAGTPPLSDNETVHLHLLDINDNPPRFPQSFYTIRVTENNAPGALLSSLT
AFDPDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEAR
DSGSPPLSSNVTVHIVIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDV
DSVHNSRITYQLLQVTDATLFSLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGDPALSA
TVTIKLSTVETAVKAYSDMTEVPLEYDIFSDLNLYLVIGLGSVSFLLLITILVTIVIKCQ
KPKAS
Download sequence
Identical sequences H3CFH2
ENSTNIP00000006996 ENSTNIP00000006996 99883.ENSTNIP00000006996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]