SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007005 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007005
Domain Number 1 Region: 3-193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-30
Family Laminin G-like module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007005   Gene: ENSTNIG00000014018   Transcript: ENSTNIT00000007160
Sequence length 1111
Comment pep:known_by_projection chromosome:TETRAODON8:21:5102270:5119982:1 gene:ENSTNIG00000014018 transcript:ENSTNIT00000007160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGFDLMAYFNVREILGTKEDDGQSSYVRLGTVPIVQQTEDIFPQGLPDEYAFVTTFKFRK
TSRREDWYLWQVFDKYGIPQVSIRLDGENKAVEYNAVGLTKDAVRAVFKNPEVDNLFDRS
WHKIALSVEAKSVSLFLDCKHIQTLPIEEREDIDIQGKTVIGKRLYDSVPIDFDLQRMMI
YCDSKHAELETCCDLPNGPLSVSQESGDRSPTSADTNSNTNRRRAKERPPGELLLPSRSQ
VGKKASVFLLQGDIGAPGAAGPKGEKGESGSIGLPGLPGQKGEKGDAGIKGDKGTSGGEM
GLDGSPGKPGLPGKDGLRGLAGVPGPTGFKGDKGDAGPPGPPGATGPPGPPGPRGLQGFP
GEPGEFGQRGPQGPPGPPGNQGHPGPPGLPGKDGLDGLPGNDGTMGDEGSPGPRGPPGER
GERGLEGPVGPKGEKGDKGKPGEKGEKGDQGKPGETGPKGDPGPTGEPGRVGDPGPPGAA
GAPGLRGVAGDAGLPGIIGPPGPAGQRGDKGDPGKPGQPGPTGTPGEPGVIGPPGPPGVL
LQGEPGPQGIQGAPGPKFPQGQPGARGEQGPPGERGSPGEGKVGPAGPPGQSGEPGAAGL
TGPPGVAMAFAMQGLPGRPGEKGSPGEPGKAADISDLDLKVGVIGIVLLNVCSDCPAGPP
GPPGIPGVPGEKGHPGPAGKSGQDGYQGQPGPAGPQGPPGADGVKGGKGDQGPPGGPGDK
GDAGHPGPPGHPGNPGLMGTPGTDGQPGPAGPPGPPGEKGKEGLKGIQGPPGLPDVNVTV
AHYLYTKLHNVINDGQGQIGKTGKDGRPGEPGEQGKHGEPGPPGNPGLRGIPGFKGHRGE
PGAPGVKGEDGKPGSPGRDGKHGKDGSRGPPGPEGLLGPRGEPGKQGEPGPSGKAGLPGT
AGIPGRAGDRGIKGDKGDLGKKGDKGHSGDPGMPGNPGVPGRKGHTGMMGMPGPPGEIGA
PGVQGPVGNPGIPGQRGESVSLEEMRRLIQEELAKQLDTRLAYLMAQIQPAHVKSTAGRP
GPPGPPGKDGSPGRPGPPGEPGMPGMNGGPAGIPGYAKDGSPGQAGAQGEPGNPGPAGQP
GPSGPPGQCDPSQCAYYASLAQRPHTKKKGK
Download sequence
Identical sequences H3CFI1
99883.ENSTNIP00000007005 ENSTNIP00000007005 ENSTNIP00000007005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]