SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007048 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007048
Domain Number 1 Region: 32-189
Classification Level Classification E-value
Superfamily E set domains 5.46e-55
Family RhoGDI-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007048   Gene: ENSTNIG00000004412   Transcript: ENSTNIT00000007205
Sequence length 193
Comment pep:known_by_projection chromosome:TETRAODON8:11:1326527:1328412:1 gene:ENSTNIG00000004412 transcript:ENSTNIT00000007205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVTEEDLRTQSGHITPEDVLGLRAATRGYLCKPEDNIYNIDFIRFKIRDLETSTILFEIA
KPPHAEEEEENRDADTSAGRFVRYQFTPAFLKLRTVGATVEFTVGNRPLNHFRMIERHYF
RDHLLKSFDFDFGFCIPNSRNTCEHIYEFPQLSESLVRQMVECPYETRSDSFYFADNRLV
MHNKADYAYNGGQ
Download sequence
Identical sequences H3CFM1
99883.ENSTNIP00000007048 ENSTNIP00000007048 ENSTNIP00000007048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]