SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007073 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007073
Domain Number 1 Region: 774-882
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-23
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 2 Region: 252-378
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 169-291
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000706
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 84-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000678
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 591-703
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000171
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 6 Region: 4-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000534
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007073
Domain Number - Region: 714-769
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00118
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007073   Gene: ENSTNIG00000004435   Transcript: ENSTNIT00000007230
Sequence length 960
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:8487466:8528440:-1 gene:ENSTNIG00000004435 transcript:ENSTNIT00000007230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECAEGSDDCHIDALCQNTLKSYNCICKPGYKGDGKQCEVEDICKPDVWAPGCLRLTL
QQAFVPTNQACKPCYHCFCLSILIDVDECADNNGGCQQVCVNTMGSYECQCTDGFFLSDN
QHTCIHRSDDGNQCLFKKTSCLLICREAPGKGGVSCESSSFELAKNQKDCTLTCNYGNGG
CQHTCDDTDTGPVCGCHQKYALHSDSKTCVETCAVNNGGCDRTCKDTATGVRCSCPVGFT
LQPDGKTCKDIDECLENNGGCDHFCRNTVGSFECSCQKGHKLLTDERTCQDIDECSFERT
CDHTCINYPGSYECLCNKGFILYGLTHCGDVDECSINNGSCEHACVNTQGSYECVCPPAQ
KLHWNKKDCVEVVKCLPNGKPAPRAQLTCTKSAGAEVCSLSCPSNALFFAESENSYTLSC
GVPVHPGKTPQKRNATTSLPTCADTDTLAPPIKQKARFKIKDAKCHLRPRNKKKSRDSSR
QRAPFPCTDDCQVTFVNLKCDSSKKRRRGRKSPTKEVSHITAEFEMEMKEEETSDSCNVD
CVREKMKQKLQSAMRTLRKSINKQQFYIQFSGTEYEVAQKPSKGPEGVEACSTGQVLQDG
KCVSCSVGTFYSGEQEQCIQCPPGTYQDTVGQLSCEPCPSSEGQGIAGAKNVSQCGGQCP
AGHFSADGFRPCQLCPLGSYQPEPGRVLCFSCGGGLMTKYEGSVSFRDCEAKVHCAPGHY
YNSSTHRCIRCPAGTYQSEFGQNYCITCPGNTTTDFDGATNVSHCKNQLCGGELGEYTGY
IESPNYPGDYPSNVDCVWTINPPHKRRILIVVPEIFLPIEDECGDVLVMRKSALPTSITT
YETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLY
ASENHQEILKDKKLIKALFDVLAHPQNYFRYTAQESKEMFPRSFIKLVRSKVTRFLRPYK
Download sequence
Identical sequences H3CFP6
ENSTNIP00000007073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]