SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007098 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007098
Domain Number 1 Region: 22-244
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.38e-35
Family Ankyrin repeat 0.00058
Further Details:      
 
Domain Number 2 Region: 261-309
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000116
Family SOCS box-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007098   Gene: ENSTNIG00000004458   Transcript: ENSTNIT00000007255
Sequence length 315
Comment pep:known_by_projection chromosome:TETRAODON8:2:4764868:4766518:1 gene:ENSTNIG00000004458 transcript:ENSTNIT00000007255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCAKEINKEPSMLHLRTPEEEQSSWDISQLRQAVLENNDRLLDEMLCQEIYRKVINLRGG
WGIAGTPLHAAVSKGNLSCLQVLLAHGALVDCVDVKAQTPLFTAVRGKYLDCVLALLRAG
ASPNGSSSNNCSPVLTAAREGDAEILKELLKRGAEVNSRSKVLLWTSSARVSSGPLYLAA
VYGHLDCFRLLLLFGADPDYNCTDAGLLSSVKQPKTVLEMCLRHGCGVEYVRLLIDFGAN
VYLPTLIIEKSTKQNEAVELLLHERGNPKALTSQCRLAVRRHLRKIGRIHCIDQLEMPSS
LVNFLQHKPATAIVL
Download sequence
Identical sequences H3CFS1
ENSTNIP00000007098 ENSTNIP00000007098 99883.ENSTNIP00000007098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]