SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007115 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000007115
Domain Number - Region: 71-128
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0189
Family C-type lectin domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007115   Gene: ENSTNIG00000004470   Transcript: ENSTNIT00000007272
Sequence length 413
Comment pep:known_by_projection chromosome:TETRAODON8:3:12559330:12567693:-1 gene:ENSTNIG00000004470 transcript:ENSTNIT00000007272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNISAEDMASYAENISIVHLDAPILPDKADVSNMTILRTGNGSIIEDQLFLNTLFAQGVS
GIFVFTALLITCHQIYTHLRSYTVPNEQRYIIRILFIVPVYAFDSWLSLLFITNEQYYVY
FDSIRDCYEAFVIYNFLSLSFEYLGGESAIMSEIRGKPIQSSCLYGTCCLVGMSYSIGFL
RFCKQATLQFCVVKPIMAVITIILQAYGYHDGDFNINGGYLYITIIYNFSVSLALYALFL
FFFATSDLLRPYEPVLKFLTIKSVIFLSFWQGMVLAILERCGVIPNALFIDGQEVGAGTV
AAGWQNFIICIEMFFAAIALRYAFTCTVYQEKKNEVPANLPQMHSISSGLKETINPGDMV
QDAIHNFSPAYQQYTQQSTQEVVPPSMNGKAAPGNKSSCRSDKIMLITSDDEL
Download sequence
Identical sequences H3CFT8
ENSTNIP00000007115 99883.ENSTNIP00000007115 ENSTNIP00000007115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]