SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007120 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000007120
Domain Number - Region: 796-880
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 0.00288
Family ATP synthase (F1-ATPase), gamma subunit 0.02
Further Details:      
 
Domain Number - Region: 407-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 141-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family Laminin-type module 0.078
Further Details:      
 
Domain Number - Region: 355-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0661
Family Laminin-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007120   Gene: ENSTNIG00000004475   Transcript: ENSTNIT00000007277
Sequence length 1030
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:69771749:69793538:-1 gene:ENSTNIG00000004475 transcript:ENSTNIT00000007277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLNVLLLLTFLISLSDCLDPTASNVCSIWESFTTSVKESYSHPYDHVTEEVCSDPQTVY
RCLHHRISYKTAYRQAVKIEYRKRYQCCPGYYESKNKCVPRCTMECVHGRCIAPDRCQCE
RGWRGDDCSSDCDDNHWGPTCSQSCKCKNRALCDPVKGTCQCSPGFIGRRCEDLCPAGTF
GKDCLQRCKCGNGGSCDKVTGECSCQEGFTGTFCKITCSKKCPARCPCQNGGICKGKGIC
TCPPGWTGAVCTEQCPEGRFGPNCAQECVCHNRGKCDAKTGQCQCAKGFTGSRCNEECAA
GTFGQDCKGVCDCANGARCYNIDGGCLCEPGFHGPHCRDRMCALGKYGMHCENTCLCQDK
NTLSCHPMKGECTCQPGWAGLFCNETCPHGFYGHGCLEPCLCVNGGVCDSSIGQCQCAPG
FTGVHCENPCKSGTYGKNCSSECSCDNYIDCSPVDGTCFCKDGWQGSRCSTPCFEGTWGP
GCNSTCLCTNGAKCNPTDGSCTCTAGWHGTHCDLTCPMGTFGPGCLKKCDCVHADDCHAA
TGVCHCLPGWWGPSCSQPCSVGLWGRHCNKTCQHCLNSDTCLRETGACVCRPGFWGVTCQ
NKCRAGTYGEQCSMPCPSCGQSYRCHHVTGECDCLPGHTGSNCDQDCPAGYYGKLCSEAC
DNCANNSTCNPRDGHCECLPGWTSSDCSMREVNRVFPTLAQNYWVCHTGPGLNPKSIGCS
FSPFLKSESSEQSGSVMVPLPPGEKESWGAISGTVVLVILVVLLLALLLLYRHRQRDKQN
NTPTVSFSTRGTVNSEYAVPDVPLSYHRYYSNPSYHTLSQNRPPLPHIPNNHDYTIKTGK
HNRVSEKPQLWHFRSNTLPTSIYDTLCENRCSCHSMQMSAAKNSLANSCSRCYPSWAIPL
LYRKQITIQDLKDTPAISSSSLNSENPYATIKDLPGLLFCPPESSYMEMKSAVPRDGPHT
GFGQSLSKNSTLHSSFFSSYFVLTGCQTAAGHATHEDPQNHYDLPVNSHIPGHYDLPPIR
QQPSASKTAQ
Download sequence
Identical sequences H3CFU3
99883.ENSTNIP00000007120 ENSTNIP00000007120 ENSTNIP00000007120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]