SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007141 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007141
Domain Number 1 Region: 232-397
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000853
Family Integrin A (or I) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007141   Gene: ENSTNIG00000004494   Transcript: ENSTNIT00000007298
Sequence length 984
Comment pep:known_by_projection chromosome:TETRAODON8:13:13185380:13198675:-1 gene:ENSTNIG00000004494 transcript:ENSTNIT00000007298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQQWASEFSVQLRDLTVKYSGSLLLQKKLKDVESIIKIVELNGDDLVRDYSNEIERMLGS
KMKSVKRLAESAEDADLYHEFNASLEFDYYNSMLINTVDEDGNSLELGAEFPLEENEHFN
NIPVNTQQSNIQVPTNVYNKDPIILNAIYNTEALNDVFISNFLKDPTLTWQYFGSSTGFF
RIYPGIKWTPDPNGVVVFDCRNRNWCIKAIFCISDLKIIINRPHFKKMQFKTTIAKHTIN
TILDTLGENDFVNIIAYTDYVRYVEPCFKGTLVQADLDTREHFKLLVDELHVKGEAKIKN
ALKEAFKILNQVRVNGQGSMCNQAIMLITDGAMEDFESVFEEFNWPDRRVRVFTYLIGRE
MTFAQNTKWIACNNKGYYTHISTLADVQENVMEYLHVLSRPMVINHDHDIIWTEAYMDTV
LFTTKAQSLLLMTSVAMPVFSKKKETLSHGILLGVVGSDIPLMEVIKLAPRYTLGPHGYA
FLITNNGYILAHPDLRPLYKDGKKLKAKPNYNSVDLTEVEWEDTEDTLRTAMVKGQTGSL
SLSVRASVDKAKRPLFLINEYFYTNIDDTPFSFGMVLTKGHGKLFFIGNVSVEEGLHDLT
SPDLSIASEWTYCETDIDPSHRKYSQLQAAVRYLQGKEPDLECDEVLLQQLLFDAVVTAP
LEAYWNTLMLSDRVEPGVETAFLGTRSGLMRVVRYAGVEARVAKNFLTPSDKDNLFTIHF
PLWYRFGSLKYYPGSTSTTLSSRKAREVRGARNVQGQLMRCAGVRSAGVTLELYLCRPHL
WLAPRKDSRRGGALRCSCRSPTRASKVTLSRAAILLLARDSQQASGQPQEAVVGQVQPSQ
LPQSVEGFPGQALASDPDAAAGLAHSQLEHPFVAVAALMRWFFSNTLTLLMDLNLCGLWH
QLFVDGHKQKKMEAMIPCDTTYPGFMLEASVREANSVIKCGRCQKMFVVQQIPDSNLVLV
VTQADCDCSRQFGPIPLTPKEIKY
Download sequence
Identical sequences H3CFW4
ENSTNIP00000007141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]