SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007163 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007163
Domain Number 1 Region: 80-212
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000424
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 16-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000893
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007163   Gene: ENSTNIG00000004517   Transcript: ENSTNIT00000007321
Sequence length 212
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:70277544:70278179:-1 gene:ENSTNIG00000004517 transcript:ENSTNIT00000007321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRLLWVSGILCTATSDRCLSGPCQNGASCVDTVDDYACICPTAGVRYMGKNCDQLYDAC
FFAPCENCSSTPGSAEYRCVCADGLTGDNCTEEVDECLSGPCSWPRSLCVDQPNGYFCRC
PEGFGGRDCRTHVTDCIDAPCENNGTCVLQPEGFECVCAPGFEGKMCEEDVDECLSEPCQ
NGAICTNGVAEFHCFCVPGFQGYNCELDINEC
Download sequence
Identical sequences H3CFY6
ENSTNIP00000007163 99883.ENSTNIP00000007163 ENSTNIP00000007163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]