SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007177 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007177
Domain Number 1 Region: 307-535
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.64e-21
Family Laminin G-like module 0.051
Further Details:      
 
Domain Number 2 Region: 123-231
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000127
Family Cadherin 0.0055
Further Details:      
 
Domain Number 3 Region: 7-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000286
Family Cadherin 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007177   Gene: ENSTNIG00000014318   Transcript: ENSTNIT00000007335
Sequence length 948
Comment pep:known_by_projection chromosome:TETRAODON8:16:7430666:7497319:-1 gene:ENSTNIG00000014318 transcript:ENSTNIT00000007335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNKHKPWIETSYHGVITENTEVVLLDPPLVALDKDAPIPYAGELVQLSSCSLGEICAFNI
QGLESPFEAVVLNGTSGEGQLRARGLVDCEAQKEYTFIIQAHDCGSGPGGAEGKKSHKAA
VHIQVNDVNEFAPVFRESEYRASVIEGKIYDNILQVEATDQDCSPQYSQICNYQITTART
PFAIDRNGNIRNTEKLSYDRQQQYEIQVTAWDCGQKRALQSVPVRIDVKPVCKPGWQEDR
NKHMDYEPGTGSKQLFPKMHLETCGGPLSSARTTVELQTSHIGKGCDRETYSEKSLQKLC
GASSGSTDLLPAPSTATNWTASLVTDSGRDSELIFRFDGRQAAKIPDWVVPQNLTDHFTI
ATWMKHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDFTQVDTFRPAE
FHWKLEQICDKEWHYVINVEFPVVTLYVDGVTYDPYLVTDDWPIHPSQIDVQLTVGACWQ
EGSGSNEADTKPLRCVGGEVKKPRFTQYFRGSLSGLTIRPGKIESQKVISCLQACKEGLD
INSLESLDKSIKFHFNPAQSILVMEGEDLDNMNTAMRKVSYINSRQFPTPGARRLRISTS
VQCFGEDTCITIPDIDAVVMVLQPSEPRITISGADRLIRPESDFRASDGIALFQDLHIVS
TVTRADAAARHTARQPEVLEEIIHNLDYCDILVLGEELRPEEESLQVEGGALLGKHLDAT
NSTSGVSVYGVDSMSSYEQVIRQVRYQHWQPTQLAERRFQLTCSELNGRYTSNEFKLEVS
VLRGSDPGEHISHIVAPPQYMQVRRPSMLHDLYPSHSSAAVPSAATVVIVMCIAALVVVV
VLGIYRIHLTHQQEVKLEETAKEAGTSWDDSALTITVNPMENLQEPQAEEEADDEITSAE
SDDSEEEVDIQLPKVERQSRKGQSWGQISSTSAQKQQRVDWSDWDGSS
Download sequence
Identical sequences H3CG00
ENSTNIP00000007177 ENSTNIP00000007177 99883.ENSTNIP00000007177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]