SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007197 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007197
Domain Number 1 Region: 56-225
Classification Level Classification E-value
Superfamily vWA-like 6.68e-17
Family Integrin A (or I) domain 0.023
Further Details:      
 
Domain Number 2 Region: 325-387
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000178
Family TFIIH p44 subunit cysteine-rich domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007197
Domain Number - Region: 289-313
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0731
Family PhnA zinc-binding domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007197   Gene: ENSTNIG00000004548   Transcript: ENSTNIT00000007355
Sequence length 394
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:70530686:70533687:1 gene:ENSTNIG00000004548 transcript:ENSTNIT00000007355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEPERAKRWEGGYERTWEVLKEDESGSLKASVEEILFQAKKRRLVQSHGQVRLGMMRH
LYVVIDCSRSMEDQDLKPNRLTSTLKLMEGFVEEYFDQNPISQMGIITTKNKRAEKLTDL
AGNPKKHAAALKKAVDSACVGEPSLYNCLSLALQTLRHMPGHTSREVLIILSSLTTCDPG
NIYELIQTLKSLKVRVSVVGLSAEVRVCTVLTRETGGSYHVILDESHFKELLMLHVKPPP
ASCSSECSLIRMAGFPQHTMASLTDQDAKPSFSMAHLEGGGGGPDLSLGGYFCPQCHAKY
TELPVECKVCGLTLVLAPHLARSFHHLFPLQVFPESSAEDPPKDRFCQACQGRLKDKSVF
TCPSCHSVFCVECDLFIHDSLHCCPCCIHRPSGP
Download sequence
Identical sequences H3CG20
ENSTNIP00000007197 ENSTNIP00000007197 99883.ENSTNIP00000007197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]