SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007218 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007218
Domain Number 1 Region: 301-490,637-683
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.22e-35
Family Phospholipase D 0.05
Further Details:      
 
Domain Number 2 Region: 692-904
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.19e-28
Family Nuclease 0.039
Further Details:      
 
Domain Number 3 Region: 75-206
Classification Level Classification E-value
Superfamily PX domain 3.4e-16
Family PX domain 0.0057
Further Details:      
 
Domain Number 4 Region: 218-321
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000178
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007218   Gene: ENSTNIG00000004569   Transcript: ENSTNIT00000007376
Sequence length 1037
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:10981775:10988356:1 gene:ENSTNIG00000004569 transcript:ENSTNIT00000007376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMLKQSEPTSSTLQLVASDMSGIMEKLDTHELDLDDGEYDATDTGAPAEHLPFTAVYHT
VGFKEPEASVFLSSPITAKILEVERFTSAQSMPAVYKIEMRHGQFTWLVKRKEKHFVDLH
RELRTYKTFMKLPLPSRSHTVKRQTRNEDRQMPVLPRGGGEDELNREGQVSSRRKQLEDY
LNNLLKMPMYRNYHATVEFIDASQLSFIHDLGPKGLEGMVSKRSGGHRIPGLNCCGQSRM
CYRWSKRWLVVKDSFLLYMKPDSGAISFVMLVDKEFSIKMDSKDTEVKHGVRIDSLSSER
RSLVLKCSSYRHARWWGQAIEGFVQKHGSAFLTDHRFGSFAREEQNIPAKWVRGTGKTYM
EDVANALEEAKEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILRRKAQQGVRIFVMLYKE
VELALGINSGYSKRTLLRLHPNIKVMRDPDHVSSAVYLWAHHEKIIVVDQSVAFVGGIDL
AYGRWDDREHRLTDVGSVTLAHLGVSLTVLVSSALRVRLGPPRRPQPPTRPTASLSDSVD
QPKLRSQGRLRRTRFSIRRHLQKHGLAAADSDSDLDDDERCVSGMEPVGSVNAGVGELFG
NTRFWHGKDYCNFVYKDWIQLDKPFDGDFIDRHTTPRMPWHDIASVVHGKAARDVARHFI
QRWNFTKLVKPKYRSQSYPCLLPKSHATAGEQRYQVPDCVNTKVQILRSASDWSAGIKYD
EESIHNAYVHVIKNSQHFIYIENQFFISCADNRHVFNKIGDAIAERIIRAHREGRKYRVY
VVTPLLPGFEGDISTGGGSAIQAIMHFNYRTINRGDCSIISQLRKEMGDQWMNYISFAGL
RTHAELEAKLVTELIYVHSKMLIADDNTVIIGGSANINDRSMLGKRDSEVAVIVEDVETV
ASLMDGQPYQAGRYGLQLRLECFRTILGAHTDPSIDVLDPISDHFYKEVWMATCARNATI
YQKVFRCLPSSDVRNILELESYLAKPGLEKEDPARAQEELKKIHGFVVQFPLQFLSEQNL
LPPIGSKEAMVPMEVWT
Download sequence
Identical sequences H3CG41
99883.ENSTNIP00000007218 ENSTNIP00000007218 ENSTNIP00000007218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]