SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007229 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007229
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-41
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 422-533
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-37
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 3 Region: 277-383
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-36
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 4 Region: 125-225
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 5 Region: 545-647
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-27
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007229   Gene: ENSTNIG00000004580   Transcript: ENSTNIT00000007387
Sequence length 658
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:70735017:70741486:1 gene:ENSTNIG00000004580 transcript:ENSTNIT00000007387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDPGCGGTFTDTDGIIISPNWPNNYAHNRQCVYVIKLPAGEKVSLNFTHLSLETHSSCSF
DYVEVRDGRSETDPLIGRYCGSSLPAPVLSSSNSLWIRFKSDSSVSHAGFRAVYTVACGG
PLSGTGLLRSPYHPNVYPHNKNCEWVISQPEGYVVTLEFQSFDVEGGSCRYDFVEVRDGP
MSSSPLLGTFCGVDLPPRLQSTQRSLYVRFSTDSSVSNYGFQAAFGSALEACQRLARPNG
PGCCAGTVAVLSLRPSPTVLAAWMQWSLQISDCSQTFTSPTGSFSSPNYPNYYPNNRDCV
FKIIVEVNMQIMLNFSSFSLEGSAPSCHFDFVELRDGGYETSPLIGKFCGSDRPPVIVSH
SNRLWVKFHSDSVITYGGFTAHWDGTQTGLGKCESRNTGSLNLTELQQRWRRLPSTNKDK
RCGGTLTTASGGFSSPNYPLPYHANAECYWKIKSSQGSQLLLSFLDFHLESSTSCTYDYL
AVYDGSSDAAPQLARLCGSQQPGTVNSTGNQLYVKLRTDGSVAAGGFLASYSTKCSDVLI
SGRHRGVLESLNFPSDYPASSQCSWTIQATTGNTINYTFAAFQLEGPASGCFYVKLYNGP
NQQAPLIGTFCGSQPPPANVTSSSSLTVVFRTDSSVSQSGFQMMWYQNDIRESLRLRE
Download sequence
Identical sequences H3CG52
99883.ENSTNIP00000007229 ENSTNIP00000007229 ENSTNIP00000007229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]