SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007249 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007249
Domain Number 1 Region: 9-229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-73
Family Calnexin/calreticulin 0.0000000701
Further Details:      
 
Domain Number 2 Region: 217-357
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.24e-58
Family P-domain of calnexin/calreticulin 0.00000018
Further Details:      
 
Domain Number 3 Region: 338-404
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000141
Family Calnexin/calreticulin 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007249   Gene: ENSTNIG00000004600   Transcript: ENSTNIT00000007407
Sequence length 459
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:14676977:14679526:1 gene:ENSTNIG00000004600 transcript:ENSTNIT00000007407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSSPIVTYRTPVPTGEVYFAETFDDGSLDRWQLSKTVKGDAEEEISKYDGKWAVEQLKEN
RVPGDQGLVLKSRAKHHAIAAMLAKPFVFKDEPLVVQYEVNFQDGIDCGGAYIKLLSDSS
SLNLEQFQDRTPYTIMFGPDKCGEDYKLHFIFRHQNPLNKDWEEKHAKRPDVDLKKFYTD
RKTHLYTLVLNPDSSYEMFIDQSSVSHGSLLHDVVPPVNPPKEIDDPSDSKPDDWDERAK
IPDPEAAKPDDWDEDAPAKIEDPDAVKPEGWLDHEEDFTPDPNAEKPEDWDEEMDGEWEA
PQIPNPACETAPGCGQWKRPMINNPEYKGKWKAPLVDNPNYQGVWKPRKISNPDYFEDLH
PFRMSPFRALGLELWSMTSDIYFDNFIITSQKEVADRWASDSWGLKKLVASANEPGIVTQ
LMAAAEERPWLWVIYLLTVGLPVGLLVLFCWPKVPHSSP
Download sequence
Identical sequences H3CG72
ENSTNIP00000007249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]