SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007259 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007259
Domain Number 1 Region: 202-534
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.07e-50
Family Diacylglycerol kinase-like 0.01
Further Details:      
 
Domain Number 2 Region: 82-163
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000994
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007259   Gene: ENSTNIG00000004610   Transcript: ENSTNIT00000007417
Sequence length 557
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:14510742:14513443:-1 gene:ENSTNIG00000004610 transcript:ENSTNIT00000007417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAEEEEAREDGGEWTLLLWTSVAVAVPVLLTLWCSAQSRRRTQMRDFFRQSRHGWSYSD
LFGKPTYCCVCAHILRGAFCHCCGVCDEPCLRRAEAVCACKQIARCMEHRWVRGNVPLAS
YCAVCRQQCGTQPKLCDLRCVWCQSTVHDCVERLGDQRCNLGEFRHLIIPPDYLHRVEPR
CGAGFPTRTSRVAPVCGSPWTPLLVLANTRSGNNMGEGLLGEFRTLLNPVQVFDLSQLSP
SKALQLCTLLPPGSVRVLVCGGDGTVGWVLDAIDSMRLKGQDQFVPRVTILPLGTGNDLS
NTLGWGAYAGEIPVEQVLRNVLEAEVVRMDRWKVQVASKGAPPAVHQHSAAPQVLSMNNY
FSVGPDALMALNFHAHREKTPSFFSSRIVNKAVYFLYGTRDCLVQECKDLDKRIECAPLE
LDGERVELPSLEGIIVCNISFWGGGCRLWEGMGDEPCPPTRLDDGLLEVLGVFGSFHCAQ
IQVKLANPVRLGQAHTVRLLLKSSTMPMQVDGEPWAQGPCTITITHKTQALMLYRSAEQT
DDDEEESSASETESATP
Download sequence
Identical sequences H3CG82
ENSTNIP00000007259 99883.ENSTNIP00000007259 ENSTNIP00000007259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]