SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007278 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007278
Domain Number 1 Region: 23-126
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 223-334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 3 Region: 414-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 134-169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 376-413
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 176-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 338-374
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000995
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007278   Gene: ENSTNIG00000004627   Transcript: ENSTNIT00000007436
Sequence length 824
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:16075857:16079009:-1 gene:ENSTNIG00000004627 transcript:ENSTNIT00000007436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQRNDKVFTSGFSNACGEGAELLHSPSGVITSPGWPFQYPAQLNCSWNIRAQPGDTVTIS
FQDFDLQGSHRCSSDWISISSYRSLDGLRVCGSSLPPPYLSTQDHVWVHFHSDDSLTGKG
FRLSYVTGKPEAPGCDVDQFHCSNGKCVPDWWRCNSMDECGDNSDEELCMDSPFSFQPCS
MNQFPCLSRYTRIYTCLPHSLRCDGSIDCQDLGDEIDCDVPTCGEWLRNFYGSFSSPNYP
DFYPPGSNCTWLIDTGDHRKVILRFTDFKLDGTGYGDYVKVYDGLEEDPRRLLRVLTAFD
SRAPVAVVSTSGQLRVHFYADKINAARGFNATYQVDGFCLPWELPCGGNWGCYTEQQRCD
GYWHCPNGRDELNCSSCQGDEFPCSRNGACYPRSDRCNYQNRCPNGSDEKNCFFCQPGNF
HCKNNRCVFESWVCDAQDDCGDGSDEESCPIMVPTRVITAAVIGSLVCGLLLVIALGCTC
KLYSLRMFERRSFETQLSRVEAELLRREAPPSYGQLIAQGLIPPVEDFPVCSGSQASVLE
NLRLAVRSQLGFTSIRLPSSGRHGNLWRRLFTLSRSRRSGSLALVSADLDDSAGSGSTGS
SGSDPLSPDSDDTDTEGERGRERGVGAVGISLPPLPPKTPPAAAVEPLASVTSSLAPLTG
APGPDSARDGPREAPPPASPIAVAPPTSTLQRLAQNLHRLARNLSRTGPSQRDQSWNEHS
PLRQLEAGRGGAEAAERRGSREEEEDVELLIPLCDSDSPPPGGDVRHVLLEPHASRLAFG
GGCRGGRDGPCERCGMVHTAQIPDACLEAAGKTESSDDELLLLC
Download sequence
Identical sequences H3CGA1
ENSTNIP00000007278 ENSTNIP00000007278 99883.ENSTNIP00000007278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]