SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007283 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007283
Domain Number 1 Region: 10-197
Classification Level Classification E-value
Superfamily Sema domain 7.72e-41
Family Sema domain 0.0075
Further Details:      
 
Domain Number 2 Region: 200-252
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000558
Family Plexin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007283   Gene: ENSTNIG00000004632   Transcript: ENSTNIT00000007441
Sequence length 358
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:70968996:70977432:1 gene:ENSTNIG00000004632 transcript:ENSTNIT00000007441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLVKQVGQGAGSESDALLGVFSRNPSTTNNSLLDFSALCVYPLDELDRHFDSTRDLCYT
NGGHLQGEGEVAYIEYEVKSSCANLPLNTIKAYPCGSDHTPSPMASRISQEAKAVLEMSS
YHLTAVAVSVREGHSIVFLGDTKGNLHKVYLGQDGEAKVYANITIQLNSPINKDLLLDQN
GRHIYIMTKNIVKKRPVAECEDHLDCQSCLSAKDPYCGWCVLQGRCCQRWECKQGSLQDQ
WLWSFKQTQQCLSIHHLSFYNISRGEKNNITISVKGLPSLGKGEAYSCFFQDTQTRATLT
TTGVVCPTPDANSLPPIDYGDEFVVLTLSLRFMNVTVAETEFTFYNCTLVQQLSGHRP
Download sequence
Identical sequences H3CGA6
ENSTNIP00000007283 ENSTNIP00000007283 99883.ENSTNIP00000007283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]