SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007293 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007293
Domain Number 1 Region: 7-262
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.34e-50
Family Ankyrin repeat 0.0000616
Further Details:      
 
Domain Number 2 Region: 523-595
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1e-19
Family SAM (sterile alpha motif) domain 0.0054
Further Details:      
 
Domain Number 3 Region: 281-363
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-17
Family SH3-domain 0.0027
Further Details:      
 
Domain Number 4 Region: 463-522
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000393
Family SAM (sterile alpha motif) domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007293   Gene: ENSTNIG00000005455   Transcript: ENSTNIT00000007451
Sequence length 1205
Comment pep:known_by_projection chromosome:TETRAODON8:18:9116998:9133290:1 gene:ENSTNIG00000005455 transcript:ENSTNIT00000007451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDQELLQAVKTEDLLTAQRLLQRPRPGKAKLLGAAKRVNVNIQDADGLAPLHHAALSG
NKELISLLLEAQATVDIKDHKVGMRPLHYAAWQGKTEPKMLLKAGSSVNGQSDEGQIPLH
LSSQHGHYDGTEMLLQHQSNPCISDAAGKTPLDLACEFGRVAVVQLLLSSNMCATMLEPK
PSDPNGVSPLHLAAKNGHIDVIRLLIQACLYINRQSESGTALHQAALCGKTEVVRLLLDS
GISAGVRNTMSQTALDIVNQFTTTQASREIKQLLRDASAAMQVRALKDYCNNYDLTSLNV
KAGDIITVLEQHSDGRWKGCIHDNRTGNDRVGYFPSNMVEVIKRAGDHPHHRNVSACQSS
PSSSRWSSVAVHPAPSSLPLNLCSHTVLNAPGLHAQAEGVKLLATVLSQSVKAKEHLLEQ
SQSVEQSATSRPLQRPAVCFYQAQAAFPAPALRKAEEDDGKKQAVVMWLGEFQLQFYTTH
FLTAGYDLDTISRMTPEDLTAIGVMKPGHRKKLMSEVSKLPATDWLPDHKPANLADWLAH
LGLSQYYQVLVQNGYENIDFISDISLEDLQEIGITKLGHQKKLMLGVRRLKELQRGEMSS
EPPRSPSTPPSSPEPRGEVRRQREGTPSPLAKPRPVPTYPQTPPHTPTQTPPQTPPHGRN
QQASPRARPRPSTKMAAADTAVPLLCLPGDEEERRRTNSLIGPESDSRYATVCRSSSANA
AAANDVTFNRSQSSVTLRPRRKGRPPTPPKRSCSSITGGDGEGDGLEEGLLGLPTYRERR
ASDCGSLGSALSSQDSGSLQRSEGASGSVRSLAAMLETSIVSGAKTLPRNLGGSSNYLQV
SPPTLRRQAGAGGLGSEEEDVLSRRRTIGGPESFPGAENDRLPREQVLQRPEPRPRSTVG
PSASSDATDGTATLRRKPRPLVTETDAPASGASTVVTMTTGSDTLRRKPRTSEHAERAVP
SDKQPEAQQNGGVVLRRRPASEAADRTEHGQETCEWMEARKSLKPPVSPKPATVNLRKAQ
ADPPTPTRRVPIPGPETAETAQSPGLPPPVSPKPRGPPTAPKPVKALPSAASSPAAGSPT
PIPQPSSPSSAPLPAPDTPSAPSLSPGLPVASPSPAQSPSSPTPHPVKPPRSSIAGLSID
LEAPGRAQQHRLEETSACLAAAVEAVEHKIKEEDAENEKKTTVSILDDIGSMFDDLADQL
DAMLD
Download sequence
Identical sequences H3CGB6
ENSTNIP00000007293 99883.ENSTNIP00000007293 ENSTNIP00000007293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]