SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007295 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007295
Domain Number 1 Region: 244-280,323-526
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.77e-28
Family Extended AAA-ATPase domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007295
Domain Number - Region: 615-676
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0442
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007295   Gene: ENSTNIG00000004643   Transcript: ENSTNIT00000007453
Sequence length 937
Comment pep:known_by_projection chromosome:TETRAODON8:18:9139504:9145686:-1 gene:ENSTNIG00000004643 transcript:ENSTNIT00000007453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEYDELFEIEDNFENQFADELEVLAQMEEVTDESSKPTKRQRRGQGDDISDIEHLLDDQ
PTTPKAKRQKQEAGVAKRLFDCQRSKAPNPSYDITPPSSPEQYEASHTVRYESPETPTRL
LTTAPPSQHVLKRPPLEGDYVTVTDSSGNRVYLRQKEEATTKGVNSRIVPGSHGALGLLA
VPIGVLRDQEIQRRHHQLMEESQHLSELLTCLRSRVNDVFVEPESLEEKENEDPLDTEAQ
LSRLWVDRFSPRHYTELLSDDFTNRCLLKWLKLWDGVVFGRERKARPARPDRQAAGQSSS
KPNQAGQNPNRFKSKVEMTEEILEAELDQHKRPKFKVALLSGPPGLGKTTLAHIIAKHAG
YNVVEINASDDRSAEVFQKRIDTATQMKSVLGVNEKPNCLIIDEIDGAPTAAINILLATL
NRKDGHSGEAAETTTKKKKKKESILLRPIICICNDLYVPALRALRQQAFLLTFPQTQPSR
LSQRLAEISLRQGMKTDMGALMSLCEKTDNDIRACINTLQFLYGRGLKQVDIRTIQGVSV
GQKDQNKGLFHLWQEIFQLPRTKRYKMRKKLKHKKRIGEGFEAAPGSGSLAQRFHHVFHL
ASSSGEYEKVSQGLYDNYLSMRVRDPNLQNVCEALDWFSFSDRLNREILHSQNFSLMRYL
PFLSVTFHLLFAHTHVPRITYPHSQHEASSRLLGSRNALSTMLSDIPACIRSRTSQHILA
LDLLPLLLDIICPKLRPVNPQLFSSREKEQMHELVDTMLAYNLSYRQDRTPEGQYTYVLE
PRVEEVVRYPSLPPRRQLTYQAKQTISREMEQEKMRRAEQLILQRNPAAVRRPSADRLAV
VQKQEEKKTRGPTPTTNHQQRLENIVSRTTVEARPEVDFFGRAVAPKPQRAQPSSDRGEK
CPNLSMGKAVGNSDVWFRFNEGMSNAVRRNVYIRELL
Download sequence
Identical sequences H3CGB8
ENSTNIP00000007295 99883.ENSTNIP00000007295 ENSTNIP00000007295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]