SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007355 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007355
Domain Number 1 Region: 24-199
Classification Level Classification E-value
Superfamily vWA-like 3.89e-32
Family Integrin A (or I) domain 0.0000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007355   Gene: ENSTNIG00000004702   Transcript: ENSTNIT00000007513
Sequence length 543
Comment pep:known_by_projection chromosome:TETRAODON8:2:5356945:5366560:1 gene:ENSTNIG00000004702 transcript:ENSTNIT00000007513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLRPSLLICYSLSLCIHDSDTSCLHLYFLCRRSGSVKNHWEEIYYFVENLAEKFKSPML
RMSFITFSSRASTIMKLTENRINIRKGLNALKREIPGGDTIMHLGLQKANEQIKRENFGP
ASVIIALTDGELQEDELISAQQEAETARSLGAIVYCVGVKDFNETQLATIADTIEHVFPV
LGGFHALRGVINSIIKKSCIEILAAEPSSVCAGETFQVVVRGNGFLHARDINQVLCSFKI
NDTFTVNEKPAGVENTFLLCPAPVVDEVGKVIYLQVSMNNGLSFISSNVHITTTECFDGT
ILLIALLVLFLLLALIFMWWFWPLCCTVVIKEPPPPPPPEPESDDEQGLPKKKWPTVDAS
YYGGRGIGGIKRMEVRWGGKGSTEEGAKLEKPKNAVVKMPEQEYEPFEPKPKKTHKKLPQ
NRKWYSPIRGKLDAIWALFRRGYDQVSLMRPQPGDHGRCINFTRVKEESAAANAQTRRPI
HSPSPPPPDYGPPTSSRSSSPTQISPPARSPPSSQLPPGPPPARTPPGLPCPPPSRPPPS
LCL
Download sequence
Identical sequences H3CGH7
99883.ENSTNIP00000007355 ENSTNIP00000007355 ENSTNIP00000007355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]