SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007396 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007396
Domain Number 1 Region: 838-961
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-25
Family Ankyrin repeat 0.000000436
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-19
Family Ras-binding domain, RBD 0.0075
Further Details:      
 
Domain Number 3 Region: 769-774,968-1024
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-18
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007396   Gene: ENSTNIG00000004742   Transcript: ENSTNIT00000007554
Sequence length 1037
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:71685391:71689492:1 gene:ENSTNIG00000004742 transcript:ENSTNIT00000007554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQMFLTVFRSNSDQNLTEVPITPETLCRDVVEFCKQPGEGGCYLAEAWRSSERMVGEKE
RMMEVLQQWGQHRVEVRYRLRQLPAPAGSRAAGLVVSRTPAENTVGVVAGAVSLEAKAPA
AQLQVSLSDLRDLAAWQQQRISSQQQLLASKEQQLRCLEVREQQELSEQEHLRLLRENAH
NQEAKLRRVRALRGQVEHKRLSNGKLGEEVQQMSQLLQQKQRELLLAASRVEQLSQQLEA
LRSSRPVAPPPPCRRELERLHREPQLAARLSSWTSDPQLQSGGNQDQSDPEAAAMERRLA
QLRQRLRRKKAALLQKDRRPVGSGGGAPQHGAPARVAAVGPYIQSSSQGRPGAAEPPEDS
SEDGPPKPPPRPLKAASGESRPGDSGEGRHASVCLRPWLSAGFLASKTSGWCSGHASTLP
RTSGLSRHASGLPACPGSGDPAGGPLPAEPSGPDRPPPVPGRTRNLENLQKDPQATAQPL
SSSGTAPLSPFSTGTFPGKTRGSGAQRRAPGLAAGYSSTLPLPGKQDKPPAAAVRPYTPE
PEPPPTLQRPPTVAASSIYSMYTQQGAPGRSLAPSGQGTLPRRPRVSHVLPVYGKPVLPA
SGGQPPSHGSSGNAAWWDPDGMEADASKTGEEPGAEHASPRPLSPTKLLPFLSNPHRNTS
DVDLEALRRRLHHAPRPLKKRSSITEPEGPAGPNIQKLLYQKTTLAAMETVPMEAVPTHT
AGSPAQAGEDGSFRDGQSAAGHEDESLAPPPLPPRSPVPDPAPCRSLLPPPPPPDEFPPY
PPPPYPSCGRSEQGGDVVDPPPPEVRGQVPPERKSILRRCGSEPPDRGARVRFNPLALLL
DASLEGEYDLVQRVIYDVDDPSAPNDEGITALHNAVCAGHAEIVKFLVQFGVNANAADSD
GWTPLHCAASCNNVQLCKFLVESGAAVFAATHSDTQTAADKCEEMEDGYAQCSQFLYGVQ
EKMGVMNRGVVYALWDYEPQQDDELRFSEGDCLTVLRREDQVEEEWWWARCGDHEGYIPR
NLLGLYLRVKPRQRSLA
Download sequence
Identical sequences H3CGL8
ENSTNIP00000007396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]