SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007399 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007399
Domain Number 1 Region: 54-277
Classification Level Classification E-value
Superfamily GFP-like 6.07e-80
Family Domain G2 of nidogen-1 0.000000656
Further Details:      
 
Domain Number 2 Region: 614-840
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-43
Family YWTD domain 0.0000000323
Further Details:      
 
Domain Number 3 Region: 516-590
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.66e-21
Family Thyroglobulin type-1 domain 0.00085
Further Details:      
 
Domain Number 4 Region: 406-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000353
Family EGF-type module 0.029
Further Details:      
 
Domain Number 5 Region: 319-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007399
Domain Number - Region: 372-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000181
Family EGF-like domain of nidogen-1 0.054
Further Details:      
 
Domain Number - Region: 288-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000559
Family EGF-like domain of nidogen-1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007399   Gene: ENSTNIG00000004745   Transcript: ENSTNIT00000007557
Sequence length 841
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:71701433:71707183:1 gene:ENSTNIG00000004745 transcript:ENSTNIT00000007557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFGNLLINTNGFVAFEVPPPQAEYLGKMPAPFKMVAVLLGDLDNSDGRGSVYFRISGKLS
GRLFVGRSSSAEELGDADLHSYVVAKEGRTYVAVSSVGASLGPALRLLPVLGGVIGWAFA
LEQPGYRNGFSIAGGEFWRQAEAVFLPGGQRLSVRQRFSGLDQHGHLVLHTHLEGRLPAV
PPGSSVQISPYQEVYRYHRSLISSSSSRGFTITHPDGTVQNRTCQWHQNIVFESCPHDDH
AHVAPPTQQLSVDQIFVMFDPENELIRFAMSTRTGPVQGGPPPEQNPCSSGTHGCDLHAV
CTPGDGDLYACQCAAGFTGDGRRCDDIDECAETPPICGSASACTNQPGTFRCLCAAGFTQ
GEACADGSPPEDRCQTGRHDCDVPERASCSAGGSAYTCSCLPGFVGDGRACRDDDECLQG
RCHLNATCSNTPGSYACRCGPGFHGDGFRCSPSDGGVLCPSCCCWRSGAQASSAAPGEAV
ITAGCAHTPAFTALEAHSCLPCPNLSASFLPERSCCGRSLTPSCFPFPERQKSACERHRA
VLGQYVPRCDAHGAYESTQCHASIGQCWCVDATGREIPNTRTGPGSTPLCIERTVMPTPV
GPTPRPDVQPVAAGTHLLFARSGRIERVPLDGYRMKTEEAGPLLHIPDRVVVAVAFDCVE
KTVYWSDITAPAISRARLGGGHVSAIVTQDLGSPEGLALDHVSRLLFWTDSLRDTVEVSK
LDGSQRRVLFHTELVNPRAIVTNPVHGRLYWADWDRDGPKIETSNMDGTGRSVLVKDDLG
LPNGLTFDLHSQQLCWADAGTRKVECMDPHRRSRTLVVEGVQYPFALVSFGRNLYYTDWR
R
Download sequence
Identical sequences H3CGM1
ENSTNIP00000007399 99883.ENSTNIP00000007399 ENSTNIP00000007399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]