SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007406 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007406
Domain Number 1 Region: 571-667
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-18
Family PDZ domain 0.000011
Further Details:      
 
Domain Number 2 Region: 1798-1868
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.14e-18
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Domain Number 3 Region: 122-149,266-322
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000852
Family Ankyrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007406   Gene: ENSTNIG00000004751   Transcript: ENSTNIT00000007564
Sequence length 1870
Comment pep:known_by_projection chromosome:TETRAODON8:5:12924700:12956745:-1 gene:ENSTNIG00000004751 transcript:ENSTNIT00000007564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHINWLVVRVLIPDLQQTKCLRFDPAATVWSAKQRVLCSLSRSLKGALNYGLFQPPGPGG
QGRFLEEERLLREYPQPISRGVPALEFRYKSRVYKQPPLEEKQICKLHTKANLRRFLDLV
QQRQVEKVSQLLERGLDPNYQDSETGAIPLRLPPRSGVSVSDSRKLNSQQLVVELKTVFV
FTCVRGACVVEHFVGDLCSRLKPLSTLPEDQILRQALFLTRVLELGPLAPPAWHLLLLTP
ASGRSFWRERSSPPFRGGALRSFRTLPSACLSPFLLLLQETCARVLLARGADKEVKNFNG
QSPSQVAIIAGNFELAELIKKHKDSDIVPFREAPAYSKRRRGPSAGNGSEPSSSSLAAPR
VLLRSNSDNNLTRPPQQGPPQPGSSALHRSLSPQLLQQMPSGSPNGNVVVRTMGRGARSR
SPSLSRLGEEVRRAQRQPRPSTSAAAQRSPTCGSGTGTGPWVLRCRAAQEETVSVLPHRN
NHTIKSSTKGKGEKDMCKNKHHNSATEVGGGGVVPGVVPGVCGDGFLLCLADSRADRADR
RKLFRHYTVGSYDSFDASRSGGGGGGGGDCVVDEKTVVLQKKENEGFGFVLRGAKADTPI
EEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLIEVNQENVVKVGHRQVVNMIRQGGN
RLLIKVVTVSRNLDPDDTARKKAPPPPKRAPTTALSMRSKSMTSELEELATLRKKKDQFP
WQPSPCVDVQKKRIVFQVTLNKVEEMTHAQKASPIDMKIATIKPRPSSRCLVTAADMNSM
YHDRQGVAVVPPTVPGAYLGIPEKGTMRKQKSIGTAEDEKQGFLTPPLLKFARSLSMPDT
SEDIPPPPAISPPSPPAYNSPAAPGPKGYGATRPSFTQNSANAVTTISQTGNVGTLRGSE
QFESTRTRGRTPVPENPYSEVGNKTLYIPAKPARRKGMLVKQSNVEDSPEKTCHMPASPS
GPVSMPTTPVERTCSSIPIPTIIVKEPSTSSSGKSSQGSSMEIEPTTPEHPPLAPTVGGS
GGLRPDDPLSLSNPFAAAIAGAVRDREKRLEAKKNSVAFQSIDMGDDDFCSPTPTPRLRQ
SKSIDEGMFSSDERLRRILAPPPAAQLGPPVGGGSGNMTDFNTPEPTVHPVTGKPLDPNS
PLALALAARDRAMKEQQNHPQNQPQNPPQVPQAPKHEAQSLPVQPSHKPDLNQPLFIDTK
RQMTEQKYETDGAREERQHRALEERKSAPADVTDASKPKSAGLLMVHTSTDPNKTSNQDA
EGQDSNRPAELKDPNQPDPLKASMLAANPLPPSARRRSIPLGDSMDEPVKLPFRIPPPPL
ASVDIDEEFEFSEPLPPPLEFANSIDIPDDQASAIAEMLKQQRRNGGPALPPYHPHAPPP
VADHHKRVPNSKPPAYAPPPDHESAVGDSGIEEVDSRSSGDPQHMETTSTVSSISTLSSE
GGFCDSTLESLYTSADGHAFLVERPPVPPKPKGKSIINRTSLYHDALIEEAPESYGTPPQ
APPPPPSSSEPPRTPTQRSSKLWGRGSDGVMAEACLEDRSAEALRGGGGVRLRRTPPAVL
SLTPLPRRRSDGCRSSRPPLRNQHSPIRNRARPPAVSGSELSVCSVLTSDLRPPPGRVAQ
FEGPGATWGLPERPLRLDRMSPEQICRLRWGRGEEGHRSLLRSSSSSFLFSSRSRKLVAF
MPVKAAFGSGDTCWPRPTDDSGTRSNATTAAALSSTPPGSLPSQTHPCSPPDSASSLTPC
SSLPPSVSPTLTDVFGLATPPMGSGGGYSLSSSCGGSGSSRSPSPLTLMQAASASGKAFA
SKPVELWSKHDVADWLESLNLAEHRDAFLDNEIEGAHLPSLQKEDLIDLGVTRVGHRMNI
ERALKLLQDR
Download sequence
Identical sequences H3CGM8
ENSTNIP00000007406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]