SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007421 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000007421
Domain Number - Region: 362-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 197-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0484
Family EGF-type module 0.07
Further Details:      
 
Domain Number - Region: 704-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.053
Family EGF-type module 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007421   Gene: ENSTNIG00000004765   Transcript: ENSTNIT00000007579
Sequence length 1035
Comment pep:known_by_projection chromosome:TETRAODON8:5:12819262:12836615:-1 gene:ENSTNIG00000004765 transcript:ENSTNIT00000007579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSRLLLLLILSFIPAAAPLNPDDPNVCSHWESYAVTVQESYAHPFDQVYYTRCTDILN
WFKCTKHRISYRTAYRRGVRTMYRRRSQCCPGFYESGNLCVPLCTEECVHGRCVSPDTCQ
CEPGWGGPDCSSGCENDLWGPHCSNKCQCRNGAKCNPITGACVCTEGFQGWRCEEPCDRG
LFGRDCLQRCRCLNGATCHHQTGQCACAPGYAGAFCEQPCPPGKHGPRCQQRCPCQNAGT
CHHVSGECSCPAGWLGPVCAQPCPGWFGINCSQECTCRNGGLCDHVSGQCQCTAGYTGER
CQDECPVGSYGPQCAHKCDCQNGGRCYHTNGACLCSDGFKGPSCQDRFCPAGLYGLLCER
PCPCRPQSTLSCHPLSGECSCAAGWTGLFCNETCPAGYHGEGCRHACSCANGADCDGETG
ACLCAPGFMGDDCSISCPAGLFGINCTSSCSCRHRSSCSHLDGFCFCSEGWQGVDCSLPC
SSGTWGLGCNQTCQCSNGAACDPANGTCTCSAGWRDEYCDAPCPGRLFGLDCRERCDASA
DGCDPVTGLCRSWRAGQPGVHCDSVCPDGRWPNCSYSCSCENGGSCSPEDGTCVCAPRYR
GTSCKRACSPGFFGQRCSQSCPQCLHSDGACHHVSGHCECLSGFVGALCNQVCPTGRFGR
ACAESCLCTNNGSCNPIDGSCQCFPGWIGHDCSRPCPQGSWGPDCIHTCNCHNGARCSAT
DGDCGCSAGWTGRHCTQRTAARAHAPRTRATHPRCAYCHFQQSAGSRVRTGASVAMATRW
RRSACVAAQLSVPWLAHTPSAPGASRVTRGSVGLPVQQHRNHEPATRAHFRGHVARETAS
QRARANTHRNSRDSRGAVRSADSAAWRPTRTRALLLLQTRSLKVPETYLPFDQQRCTLLP
LHIYQRVNINLKDLLFTNYTKGSLSSTCSLNSENPYATINDPPALCKHSESSYVEMKSPA
RHEQLPTAAAPGRNVYDVEPTVSVVQGVVAAAIPGLPGYVQNPYDFPRNSHIPCHYDVLP
VRASPSHSQTPPLPG
Download sequence
Identical sequences H3CGP3
99883.ENSTNIP00000007421 ENSTNIP00000007421 ENSTNIP00000007421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]