SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007426 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007426
Domain Number 1 Region: 348-587
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-50
Family YWTD domain 0.00000273
Further Details:      
 
Domain Number 2 Region: 34-297
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-50
Family YWTD domain 0.00000344
Further Details:      
 
Domain Number 3 Region: 650-873
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-46
Family YWTD domain 0.00000891
Further Details:      
 
Domain Number 4 Region: 962-1143
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-29
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 5 Region: 1274-1311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000128
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1197-1235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 7 Region: 1237-1273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 606-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000475
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 302-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000014
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 10 Region: 1154-1207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000051
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007426   Gene: ENSTNIG00000004770   Transcript: ENSTNIT00000007584
Sequence length 1573
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:21836712:21853407:-1 gene:ENSTNIG00000004770 transcript:ENSTNIT00000007584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQTSPTEETPRRDAPLLRLGACDQPLGRSLEGLPLLLFANRRDVRLVDAGGARGESAVVV
SDLVDAAAVDFLYEEGIIFWTDVSEEAIKQTRWNLSSNYALGTGQTVVVSGLASPDGLAC
DWLGKKLYWTDSETNRIEVANLDGSSRKVLFWMNLDQPRLALNPAQRYMYWTDWGEEPRI
ECAGMDGSNRKVLVNQNIYWPNGLTIDLLEQKLYWADAKLSFIHRANLDGSAREAVVEGI
LTHPFALTLSGETLYWTDWQTRSIHACSKQKGDGVREILSGIFSPMDIQVLEPSRQPYLH
TPCGDNNGNCSHLCLLSPVQPFYSCACPTGVQLKPDGRTCKPGAEQLLLLARRTDLRKIS
LDLPDFSDIVLQVVEDIRHAIAIDYDPVEGYVYWTDDEIKAIRRAHIDGNASTMLVTTEL
KHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSENIDEPRAIVLDPVNGYMYW
TDWGKQPKIERANLDGSDRTVLVNTYLGWPNGLALDYSTGKLYWGDAKTDKIEVIDADGT
NRQTLLDDNLPHLFGFTLLGDFIYWTDWQMRSIERVHKVTAARETIIDQLPDLMGLKATN
VTETHGTNDCAVNNGGCSHLCFWCQRAVRCACPMGMELLPDLHTCVVPEAFLLFTNRDSI
RSISLGTNGNDVAIPLTGVKEASALDFDVSERRIYWTDIQAKTINRAYMNGSAVEHVIEY
GLEYPEGMAVDWMGRNIYWADTGTNRIEVARLDGQYRQVLVCKDLDNPRSLDNPRSLALD
PASGYMYWTEWGGRPRIARAYMDGKATTTLVDKVGRANGLTIDYVAHRLYWTDLDTCMIE
STNMQGLQRQVIVDELPHPFGLTQYQDFIYWSLPPEVKHAMKTDEQREAPLRLAGPRLCS
VRWQTHSRPGSPGADTPRGGWGVLLQPPRRWRHSSRPKLKDRKEEGRSGSSVTVNGNSQA
ADSQIHDLSLDPYSRHIYWTCETTNTINVQRMSGQSVGVVLKDDANKPRAIVVSAERGYM
YFTSVQERSAKIEAASLDGTERECLFATGLFRPVALALDNKAGKLFWVDSDLKRIESSDL
TAGANRIVLQDSSILQPAGLTVLGDHLYWIDRQQQMIERVDKLTGDGRTRVQGRLAYLTS
IHAAQTMERQELESHPCSRDNGGCSHICIAKLDGTPRCSCPVHLVLLQDLLHCGEPPTCS
AEQFTCTTGEIDCIPMAWRCDGFPECADSSDEENCPVCSSLQFKCDRGGCIDAHRRCNGE
PDCADQSDERDCQTICPPHQFRCGDNQCISKKQQCDTYSDCPDGSDELSCDTVSPSHNTS
SGPNAIVSVVAIILLVLVVGGAYFFCQRVSRCYKGQSGSFPHEYISGTPHVPLNFIAPSG
SQRGTFQGISCGKSMMSSISLMGSSSSGAPLYDRNHVTGASSSSSSSTKGAFYPQILNPP
PSPATDRSLYNAEVCYSSNSPSSTRSYSTTRSAARAPPTTPCSTDVCDSDYTPHHPPGAL
GSSGRRWKASGHGSLGKHKYYVDLNSDSDPYPPPPTPRSQYLSAEESCPPSPSTERSYFH
LCPPPPSPCTDSS
Download sequence
Identical sequences H3CGP8
ENSTNIP00000007426 99883.ENSTNIP00000007426 ENSTNIP00000007426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]