SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007429 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007429
Domain Number 1 Region: 2-544
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.69e-172
Family Motor proteins 0.0000000231
Further Details:      
 
Domain Number 2 Region: 1706-1822
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-24
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 3 Region: 999-1102
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.95e-20
Family First domain of FERM 0.04
Further Details:      
 
Domain Number 4 Region: 1094-1188
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000301
Family Second domain of FERM 0.0057
Further Details:      
 
Domain Number 5 Region: 1823-1913
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000113
Family Third domain of FERM 0.014
Further Details:      
 
Domain Number 6 Region: 1605-1713
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000165
Family Ras-binding domain, RBD 0.093
Further Details:      
 
Domain Number 7 Region: 1316-1380
Classification Level Classification E-value
Superfamily SH3-domain 0.000000195
Family SH3-domain 0.004
Further Details:      
 
Domain Number 8 Region: 541-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000814
Family Motor proteins 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007429   Gene: ENSTNIG00000004772   Transcript: ENSTNIT00000007587
Sequence length 1927
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:71829929:71845609:1 gene:ENSTNIG00000004772 transcript:ENSTNIT00000007587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLQACDERNYHIFYCMLNGMTADEKKLGLSRPGDYTYLTMGKCTLCDGRDDTKEYSNIR
SAMKVLMFTDKENWEISKLLAAILHMGNLRYDARTYDNLDACEVVRSPHLTTSATLLEVD
CKDLMNCLTSRTLITRGETVSTPLSMDQALDVRDAFVKGIYGVVKPMSSQPKYVRRSIGL
LDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLEHINWQHIEFTDNQDA
LDMIAIKPMNIISLIDEESRFPKGTDTTMLNKLNFQHKLNSNYIPPKNDHETQFGIQHFA
GVVYYETRGFLEKNRDTLYGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFK
RSLELLMRTLGVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIR
YTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRISEVVLGRDDDWQMGKTKIFLKDHHDML
LEIERDKAITDKVILIQKVVRGFKDRSTFLKMRKSATLIQKTWRGYQCRKNYGAMRVGFS
RLQALVRSRKLCASYHVARQRITYFQGRCRGFLVRRAFRRRLQAVVIIQAYTRGMIARRL
YKRLRGEYHRRLEAEKMRLAEEVKLRNQMSAKRAKAEAERNHQERLAQLAKEDAEREKNE
KEEARKKKEMVEQMEKARMEPVNDSDMVDKMFGFLGTTSSFPGQEGQAPAGFEDLERSHR
ELEEEDLDEALPLPEDDEEEDLSEYKFAKFAATYFQGTTSYTYVRRPLKQPLLFHDDEGN
QLAALAVWITILRFMGDLPEPKYHTAITDGSEKIPVMTKIYETLGKKTYKRELQALQGEG
EVPQSDSHKKNSVRHKLVSLTLKKKSKITEEVTKRLTDGEYSLHGNSMLEDRPTSNLEKL
HFIIGNGILRPALRRDEIYCQICKQLTQNPSKSSHARGWILISLCVGCFAPSDKFVKYLR
NFIANGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLL
ADSATTAKELCTALSEKVNLQDRFGFSLYIALFDKVSSLGSGNDHVMDAVSQCEQYAKEQ
GAQERNAPWRLFFRKEIFTPWHCPSDDHIATNLIYQQIIRGVKFGEYRCDRKDELAELAS
QQYYIDYGSEVLLERLLSLIPSYIPDREISTSRTVEKWAHFIMAAHKKGIYAQKRFDPQK
VKEEVVDFARHKWPLLFSRFYEAFKFSGPTLPKNDLIIAVNWTGVYFVDEQEQVLLEMSF
PEITAVSSSRGSKLQSQSFTLATIKGDEYTFTSNNAEDIRDLVVSFLEGLRKRSKFVVAL
QDNPNPTGEESTFLSFLKGDLIVLDQDTGEQVLNSGWAHGVNERSKLRGDFPADCVYVLP
TMIYPQQELVALVTMTPAQRQESVRVSQLVLPESVDRVKPYTLEEFSYDYFRPPPKHTLS
RVMVTKNRGKDKLWSCTREPLKQPLLKKVVNHEDLSQEACLSFIDILEKKYMGDYPSKRT
RSVNELTDQIFEAALKAEPLKDEIYSQIIKQLTDNHVKYSEEKGWELLWLCTGLFPPSNV
LLPHIQRFLQSKKHHPLSGDCMQRLHKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFP
DDTDEAFEVESSTRAKDFCQNISSRLLLKSAEGFSLFVKISDKVISVPEGDFFFDFVRHL
TDWIKKSRPATKDGIIPCLTYQVFFMKKLWTSTVPGKDSFADSIFHYYQELPKYLRGYHK
CSREEVFQLAALIYRVKFEDDKSHFPTIPKMLRELVPQDLIRQMSPDDWKRSVVAYFNKH
AGKSREEAKLMFLKIIYKWPTFGSAFFEVKQTTEPNFPEILLIAINKHVGMGRYPKTKDI
LTTHPFTKVSNWSSGNTYFHITIGNLVRGSKLLCEPLLGYKMDDLLTSYISQMLTTMNKQ
RSGRSQT
Download sequence
Identical sequences H3CGQ1
ENSTNIP00000007429 ENSTNIP00000007429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]