SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007442 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007442
Domain Number 1 Region: 7-96
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.44e-18
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007442   Gene: ENSTNIG00000004784   Transcript: ENSTNIT00000007600
Sequence length 599
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:19709173:19719547:-1 gene:ENSTNIG00000004784 transcript:ENSTNIT00000007600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPEKSRYPVHHLVWHNQARQLEKELASKAQMDLESLDPRGRTPLHLAVTLGHLDCARLL
LQQGADVSKENHNGWTVLQEAVSTRDPEMVRLVLRYRDYQRTAKRLASIPVLLERLRQQA
QDFYVEMKWEFTSWVPLVSRICPSDTCRVWKSGQCLRVDTTLMGFEQMTWQRGNRSLIFR
GKDSTAEVMEVDHDRQLVFCEALSISSLTGLPHGCVNGDAGGLGLLAMVQPSEQQVAARL
AAPVVTTQLDTRNIAFERNKTGILGWRSEKTELVHGYEAKVYAASNVELITRTRISHLSD
QNKNKTRGGKTPLQNFFGIAEQHIGSSNGALMTEMSCPAVTNPATLTAEEYFSSGWSPTL
RDIGPPCQLTTKTQRFKAKLWLCESHPLSLAEQVAPIIDLMAISNTLFAKLRDFITLRLP
PGFPVKIEIPLYHILNARITFNNLNGCEDGELGLEEDEERDALGSSLPSPGSDASSVSSS
TRVIPSCVFEVPPGYAVLGSKQREPLREEEEDLLQFAIQQSLLEAGSEHDQVTIWEALTN
SKPGTHPFPCTPCHLERSEVTQHVKKTSTSITTTTQQGVFWFHLPPQGPGQAQPPQQPP
Download sequence
Identical sequences H3CGR4
99883.ENSTNIP00000007442 ENSTNIP00000007442 ENSTNIP00000007442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]