SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007443 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007443
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.4e-30
Family Pyk2-associated protein beta ARF-GAP domain 0.0022
Further Details:      
 
Domain Number 2 Region: 48-81,134-229
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-20
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007443   Gene: ENSTNIG00000004785   Transcript: ENSTNIT00000007601
Sequence length 695
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:19720244:19735288:1 gene:ENSTNIG00000004785 transcript:ENSTNIT00000007601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASEMSRKLPRTEACADCSAPDPGWTSINRGVLICDECCSVHRSLGRHISIVKHLRHSGW
PPALLQMVQTLASNGANSIWEHSLLDPAQVQSGRRKPNPQNKVHPTKSEFIRAKYQMLAF
VHKLPCRDDDGVTTRDLSKQLHSSVRTGSLETCLRLLSLGAQANFFHPEKGTTPLHVAAK
AGQILQAELLVVYGADPGAPDINGRTPMDYARQAGHVELAERLVECQYELTDRLAFYLCG
RRPDHKNVHYIIPQMADRARARPKCPTQSLDLSELAKAAKKKLQALNNRLFEELAMDVYD
EVDRRENDAVWLTTQNHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLII
DILSDAKRRQQGKGLSSPVDPLDLGLDDDDQHDYDSVASDEDTDSELTAQSNNTQRSNRA
KSMDSSDLSDGPITLQEYLEVKKALASSEAKVQQLMKVNNNLSEELRRLQKEQLNLHKRG
GFNKKKKKPPGGGTVPGPPRAAPTPTPEESASPFSMYEPGPPPSLWPTGPQPWTPSQPAY
SPSALPVVLFPAPVFHFSPSVRFSLCFFSSFRPLLHSRIPSSQVPKLEKHSSGNDSDYDN
TQTYDVSLSLGRSSEEEGRGEPEEGGGGEAGEADPTLPCTENVILKTEQVTKNIQELLRA
AQESKHDSFVPCSEKIHAAVTEMASLFPKHPVFHP
Download sequence
Identical sequences H3CGR5
ENSTNIP00000007443 ENSTNIP00000007443 99883.ENSTNIP00000007443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]