SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007447 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007447
Domain Number 1 Region: 19-198
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.14e-64
Family Fibrinogen C-terminal domain-like 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007447   Gene: ENSTNIG00000004788   Transcript: ENSTNIT00000007605
Sequence length 198
Comment pep:known_by_projection chromosome:TETRAODON8:2:2740410:2748408:1 gene:ENSTNIG00000004788 transcript:ENSTNIT00000007605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWQGFFVLLILVAPILADHHKHSMPADCSEIHHSSRGEYTIFPAGERSAVMSYCSQVMCD
MDTDKGGWTVSMARLDGTVNFYRPWNQYKVGFGSPLSEHWIVGLDNLHYMTSNKKYELRV
VLEDFDGKTAFANYGSFSVGDECSGYQLTVDGFSDGGAGDGLSSHNQMKFTTLDRDNDLY
DKNCARLFLGAFWYNSCH
Download sequence
Identical sequences H3CGR9
ENSTNIP00000007447 99883.ENSTNIP00000007447 ENSTNIP00000007447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]