SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007460 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007460
Domain Number 1 Region: 53-398
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-80
Family Protein kinases, catalytic subunit 0.00000184
Further Details:      
 
Domain Number 2 Region: 998-1057
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000493
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0046
Further Details:      
 
Domain Number 3 Region: 1075-1192
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000717
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007460
Domain Number - Region: 1224-1336,1370-1518
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00602
Family Tricorn protease domain 2 0.029
Further Details:      
 
Domain Number - Region: 538-649
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0602
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007460   Gene: ENSTNIG00000004801   Transcript: ENSTNIT00000007619
Sequence length 1687
Comment pep:known_by_projection chromosome:TETRAODON8:14:10192868:10205340:1 gene:ENSTNIG00000004801 transcript:ENSTNIT00000007619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQVRLKRLEELLLEQKEAGCLSVEALLALLLCLFSECSQSPLRREKHVADFLDWVKPF
STTVKDLRLHRDDFEMLKVIGRGAFGEVAVVKMKQTERVYAMKILNKWEMLKRAETACFR
EERDVLVRGDSQWITTLHYAFQDENFLYLVMDYYVGGDLLTLLSKFEDRLPEDMAKFYLA
EMVLAIHSIHQQHYIHRDIKPDNVLLDMNGHIRLADFGSCLRMMEDGTVQSSVAVGTPDY
ISPEILQAMEDGMGRYGPECDWWSLGVCLYEMLYGETPFYAESLVETYGKIMNHEERFQF
PSHVSDVSEDAKDLIQRLICSRERRLGLNGISDFKSHGFFSGIDWDNIRSAEAPYIPDVS
SPTDTSNFDVDDDVLKNPEISPPLSHTGFTGQHLPFVGFTFTTNSCFADGGSISRAEAAP
AAAGQQLEAFERRIRRLEQEKQELNRKLQESTQALQAPRGGALARDKELKKLNEEIERLK
QKLADSDRLEHQLEEAVMLQQDYESSASKLKTLEKQVKMLRQEKEEVHKQLADALERLRS
QSKELKEAHSQRKLALQEFSELSERLADLRSSKQRLSRQLRDKEEEMDALLQKMDTVRQD
IRKTEKIRKDLEAQLDDAKAEASKERKLREHSELYSKQLETEVERLKSQQGRGAPAGTAE
SQQEVSRVKAELDKKILFYEEELLRRDSALSSEIKNLRKDLHESEGAQLSANKELLQLRD
KLDKAKRDRQTEMDEAVAALKEKHEREKNLLTEENRKLTAENDKICSLVDKLRAQNRQLE
DDLQDLSSKKESVAHWEAQIAEIIQWWVSEENAGGYLQALATKMTEELETLRSSSLGTRP
LDPLWKVRRSQKLDMSARLELQSALDAEIRAKQLVQEELRRVKAANINLESKVKDSEERI
KELEEQMETLKTEMEESHGHHDKGLKLPDFQDSIFDYFNTSPLAPDLTFRVSHHTDRDPS
QQESEATPSSPSSSLQDSKGAPVPASSPPTSQSVVLTSPKPRAHQLSIKTFSSPTQCTHC
TSLMVGLARQGYACEVCSFICHVSCKDHAPCVCPIPAEQSKRPQGIDVQRGIGTAYKGYV
RIPKPSGVKKGWQRVLAVVSDCKLFLYDVPEGKSTQPGVGASLVLDLREEAFSVSSVLAS
DVIHATRKDVPCIFKITSSQLIPALSSVSLLVLAESEAEKRKWVRVLEGLQSILSKNLLR
SHHVHVPHEAYDASLPVIKSALSAAVLDRERIALGTEDGLFVVEVTRDVIVRAADSKKTY
QIDLIPKEKVVALLCGRNRQVHLYPWEVLDGAEPTFDVKLTDTKGCQALTTGLLRPGGPA
CLLAAVKRQVQCYEITRSKPHYRRLWEVQAPGPVQWLGMVRERLCVGYPSGFALLGLQGE
TSPVSLVSPADPSLAFLAQQPGALHALEVGSSELLLCFSQLGVYVDSQGKRSRTQELMWP
ATPVAISSNWSHLTVYSEYGVDVFDIHTADWLQTISLCKIRPLNAEGTLNLLTSEPSRLI
YFSNSCSEGELTIPDTSDHSRRLMVRTRSKRKFLFKVPEEERLQQRREMLRDPELRSRMI
SNPTNFNHVAHMGPGDGMQALMDLPLQSAVPSSHEDLAKDRPRPLSSISRQQRSKTHITR
TASGTSDFGGGASSRSILDLDQDLDREPDSDSTKHSTPSNSSNPSSPPSPNSPHRSQLTL
DSMDMEP
Download sequence
Identical sequences H3CGT2
ENSTNIP00000007460 99883.ENSTNIP00000007460 ENSTNIP00000007460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]