SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007470 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007470
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.8e-46
Family Ankyrin repeat 0.000000499
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007470
Domain Number - Region: 321-364
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0366
Family Apolipoprotein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007470   Gene: ENSTNIG00000004810   Transcript: ENSTNIT00000007629
Sequence length 372
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:71955264:71956931:-1 gene:ENSTNIG00000004810 transcript:ENSTNIT00000007629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVDLGKRLLEAARKGQDDEVRNLMANGAPFTTDWLGTSPLHLAAQHGHYSTADVLLRA
GVSRDARTKVDRTPLHMAAAEGHTVIVELLIRSGADINAKDMLKMTALHWAAQHGHHGVT
ETLIKHGADVHALSKFDKTPFDIAVDIQNTELMLLLQRTQEGMQNQVNMNQVNLNQVNMN
VETSSSTNQPQFIIQGIPAIQGGVVNLTELLNKANAGVSASPGDTEEALAASALDSNIQH
AAVVNESGQRVITIVTDQHGNLQTTGGMTQPFFVTMQHGQQMLAVPANTVTEEVVSEEPQ
PPPSRKRKLEVTNNHSEAGETLLQELLQRQLQEANRKAQEYRQQLLQKEQEAEEYRIKLE
AMSQSQASKANS
Download sequence
Identical sequences H3CGU2
99883.ENSTNIP00000007470 ENSTNIP00000007470 ENSTNIP00000007470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]