SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007503 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007503
Domain Number 1 Region: 132-324
Classification Level Classification E-value
Superfamily vWA-like 1.02e-44
Family Integrin A (or I) domain 0.00043
Further Details:      
 
Domain Number 2 Region: 333-522
Classification Level Classification E-value
Superfamily vWA-like 7.63e-39
Family Integrin A (or I) domain 0.00089
Further Details:      
 
Domain Number 3 Region: 4-94
Classification Level Classification E-value
Superfamily LCCL domain 2.22e-22
Family LCCL domain 0.0000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007503   Gene: ENSTNIG00000004843   Transcript: ENSTNIT00000007663
Sequence length 526
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:72176136:72179370:-1 gene:ENSTNIG00000004843 transcript:ENSTNIT00000007663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVGCATRGADLPGASVVLCPPACSQGRVSVFGTGPFAAVSSVCGAAIHRGVLGPSGGPV
RVHKLPGQDNYRSSLSHGVQSQTLSQWTSSFSVTSRTSDQFYKINQLCVPAKKPTKKKLT
MKKALIPGNKADCKIDVAMVIDSSNNIGRRRFNLQKNFLIKLAAMMKVGQTGPHMGVIQA
SDTPRTEFLLSNYTQPKELLFAIKELGYLGGDSNTGKAITHAAETFFQQERGGRRGYPRV
MVVLVDGWPSDSLEQAAMLAREFGINVFLVSVAKPAPEELPMVPDKDFMKKAVCRDNGFF
SYGIPSWFSSSKHVKALSQRLCSLDSLVCSKTCFNSVNIGFLIDGSSSVGHTNFQLVLDF
LSRVAATFDISDVGARILPGAPGAVQYTYDQRLEFGFLDQPNKDEALAALRRISYMSGGT
ATGEAISFSTQNLFRFLAGRRTAPGRNFLVVVTDGQSYDDVRRPAMEAQARISVFSVGVA
WAPLDDLRAMSSEPKDSHTFFSREFSGLSDLVPVLVRGICRDFSEK
Download sequence
Identical sequences H3CGX5
99883.ENSTNIP00000007503 ENSTNIP00000007503 ENSTNIP00000007503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]