SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007527 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007527
Domain Number 1 Region: 289-367
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.67e-25
Family Intermediate filament protein, coiled coil region 0.00095
Further Details:      
 
Domain Number 2 Region: 59-96
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000994
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007527
Domain Number - Region: 95-204
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.012
Family Myosin rod fragments 0.016
Further Details:      
 
Domain Number - Region: 172-288
Classification Level Classification E-value
Superfamily Prefoldin 0.0497
Family Prefoldin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007527   Gene: ENSTNIG00000004865   Transcript: ENSTNIT00000007687
Sequence length 405
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27118699:27120677:1 gene:ENSTNIG00000004865 transcript:ENSTNIT00000007687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SARSTGGYGDGQIRPRYAASAFASSGGYGTKISVASGGFSRGGSGGSTSYGAGGSVEIGA
NEKATMQNLNDRLATYLEKVRSLEKANAELEIKIRQFLESKTAPTSSDYSAYMATIADLQ
GKIQDATRVNGGIYLSIDNAKLAADDFRTKYENELAMRQSVEADIGGLKRLLDELTLARS
DLEMQIEGLKEELIFLKKNHEEEMAALRNQMSGQINVEVDAPQVDLSAVMAEIREQYESV
AAKNNKDLEAWFKAKTDELNKQVAASTEIISTSKSEVTELRRTLQNLQIELQSQLSMKAA
LEGTLADTEARFSMQLQRLQSQVTALEEQLMQLRADLERQSREYQVLLDIKTRLEMEIAE
YRRLLDGQGSIGHTSTSSTSTTSRVVVVTQEIQDGRVVASSTTTG
Download sequence
Identical sequences H3CGZ9
ENSTNIP00000007527 ENSTNIP00000007527 99883.ENSTNIP00000007527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]