SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007529 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000007529
Domain Number - Region: 463-506
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00502
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 
Domain Number - Region: 161-207
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0607
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007529   Gene: ENSTNIG00000004866   Transcript: ENSTNIT00000007689
Sequence length 675
Comment pep:known_by_projection chromosome:TETRAODON8:21_random:3119375:3123693:-1 gene:ENSTNIG00000004866 transcript:ENSTNIT00000007689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENLTLVFSCPKPQNVYTVEIKKGIDCKETPCSGEIFRPQSSLFPNFNRTFIWDLGVKPSQ
AFQLDLPEGGMRQILNGETCPDEHTYSIVTYLRTGPATIGTFCTGGTITTILVLYKALMT
LQVPGHRELDPVDFTLSNGPETSTMATVKVSLPRGVSSTGFFAANYPNDFPDKQQVEWDF
TVPGMHNYTVHFQAHTAPECLNGKVEVEYHKQGKSVTRLALTDPQPEHQQGDFKMVLKNC
ETNRTLQGLTLDYKVSVMRSGHPGKMLCTVDLTKHKDVSLQLLKVGSDPYCEMSVNSKIE
EKINVAAGTIASLSFLDCPSQDVRLTATKTIACQHLGSCPSSLLTVPSLDSCLPIPLHSF
TWHMNIPHDSTVDLMSPNGSLHQSLPGQECSDSLSLHVAESDGLSLGDFCFNGAIQKIQA
HTNISVTARVPDFKKSRGPFLHASFNQEIQDTFIYRISPEEPQTLLATPNWPQGMKPSST
VSWVVTLPSQYEADLRFFNVSQPKCDNSHTSIKVMLLGQEDEILSRREDQPKDYDMLVPE
SFYLNMSNCIPQEGQFKAMAKIVLQKKSNLLPIILGVAGAFLLLLIILAVVCVLKKKKKS
EKANKNSSIYMGKASIFRPDEIRFKSRSDNNSHIYDSIDETMVYGHLLPDSSYTDSLHGS
YSGMQVDSYQTFSGP
Download sequence
Identical sequences H3CH01
ENSTNIP00000007529 ENSTNIP00000007529 99883.ENSTNIP00000007529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]