SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007545 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007545
Domain Number 1 Region: 1-455
Classification Level Classification E-value
Superfamily Sema domain 2.22e-164
Family Sema domain 0.000000000261
Further Details:      
 
Domain Number 2 Region: 451-502
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000227
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 516-604
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000155
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007545   Gene: ENSTNIG00000004881   Transcript: ENSTNIT00000007705
Sequence length 695
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:72631078:72635941:-1 gene:ENSTNIG00000004881 transcript:ENSTNIT00000007705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLDEDGGWLLVGGKDHIYLLQPDSLEVAAATVSWPAPREHVERCRLAGKSPETDCANFV
RLLQPFNKTHVYACGTGAFHPQCTYVHVSFNAQQEPSLVLSRVVESGRGKCPFSPREPFT
AQLTGGELYSGTSVDFMGANSGIFRTSRLYIRTEAYDRHWLNEPTFVSSFSVPDTHSADD
DKVYFFFKETAVEGEQWDRRRHSRVARVCKNDVGGRRSLINRWTTFLKARLLCSVPGPSG
VDTHFDELEDIFVLETKDPQNPTIYGVFSTSSSVFAGSAVCVYSMASIRAAFNGPFAHKE
GPEHRWVEFRGRVPYPRPGTCPSQTYDALLRSTLDFSDQLVSFVRQHQLMWEPVRPLGGR
ALLSRTRGQHAFRRLVVDRVDTEDRTYEVLHLGTDDGKVLKVVTGGTEDVLLEELDVFQS
PSPVLRMALSTKRQQLYVSSELGVVQLGLQRCRFYGSSCAECCLARDPYCSWDGQTCSGF
LTPNKSRARRQDVRYQDPWTQCPVTEDVSLFSQPLEVKVVYGVEGNSSFLECLGRWPQAE
LRWTFQRTEKQHQAQPLRGDEDHLVLMGRGLLLRHLQLAHSGVFTCTSHERSFSQALARY
RLHVIASDALQPGHRLQQSQVLLGQAAVSPPLPAPRKSWLPPQLPARSLKHGLGTSQDVH
EDCEQLWQREKRRQQKLRTLKQKQEIRRARVRRNN
Download sequence
Identical sequences H3CH17
ENSTNIP00000007545 99883.ENSTNIP00000007545 ENSTNIP00000007545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]